BLASTX nr result
ID: Cephaelis21_contig00039218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00039218 (755 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330709.1| cytochrome P450 [Populus trichocarpa] gi|222... 90 4e-16 ref|XP_002305292.1| cytochrome P450 [Populus trichocarpa] gi|222... 90 6e-16 ref|NP_189154.1| cytochrome P450, family 82, subfamily G, polype... 89 1e-15 ref|XP_002885694.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata] g... 89 1e-15 ref|XP_002883585.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata] g... 89 1e-15 >ref|XP_002330709.1| cytochrome P450 [Populus trichocarpa] gi|222872313|gb|EEF09444.1| cytochrome P450 [Populus trichocarpa] Length = 511 Score = 90.1 bits (222), Expect = 4e-16 Identities = 37/53 (69%), Positives = 47/53 (88%) Frame = +1 Query: 595 EAIVKETLRLYPPAPLSGPREAIEDCYVGKFFVSKGTHLIVNLWKLHRDPRIW 753 +AIVKETLRLYPP PL+G REA+EDC++ ++V KGT L+VN+WKLHRDPR+W Sbjct: 361 QAIVKETLRLYPPGPLTGIREAMEDCHICGYYVPKGTRLVVNIWKLHRDPRVW 413 >ref|XP_002305292.1| cytochrome P450 [Populus trichocarpa] gi|222848256|gb|EEE85803.1| cytochrome P450 [Populus trichocarpa] Length = 516 Score = 89.7 bits (221), Expect = 6e-16 Identities = 38/53 (71%), Positives = 46/53 (86%) Frame = +1 Query: 595 EAIVKETLRLYPPAPLSGPREAIEDCYVGKFFVSKGTHLIVNLWKLHRDPRIW 753 +AIVKETLRLYPP PL+G REA+EDC +G + V KGT L+VN+WKLHRDPR+W Sbjct: 367 QAIVKETLRLYPPGPLTGIREAMEDCSIGGYDVPKGTRLVVNIWKLHRDPRVW 419 >ref|NP_189154.1| cytochrome P450, family 82, subfamily G, polypeptide 1 [Arabidopsis thaliana] gi|75311523|sp|Q9LSF8.1|C82G1_ARATH RecName: Full=Cytochrome P450 82G1 gi|9294175|dbj|BAB02077.1| cytochrome p450 [Arabidopsis thaliana] gi|332643468|gb|AEE76989.1| cytochrome P450, family 82, subfamily G, polypeptide 1 [Arabidopsis thaliana] Length = 515 Score = 88.6 bits (218), Expect = 1e-15 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +1 Query: 595 EAIVKETLRLYPPAPLSGPREAIEDCYVGKFFVSKGTHLIVNLWKLHRDPRIW 753 +AIVKET RLYPPAPL+G REA EDC+VG + V KGT L+VN+WKLHRDP+IW Sbjct: 365 QAIVKETHRLYPPAPLTGIREAREDCFVGGYRVEKGTRLLVNIWKLHRDPKIW 417 >ref|XP_002885694.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata] gi|297331534|gb|EFH61953.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata] Length = 515 Score = 88.6 bits (218), Expect = 1e-15 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +1 Query: 595 EAIVKETLRLYPPAPLSGPREAIEDCYVGKFFVSKGTHLIVNLWKLHRDPRIW 753 +AIVKET RLYPPAPL+G REA EDC+VG + V KGT L+VN+WKLHRDP+IW Sbjct: 365 QAIVKETHRLYPPAPLTGIREAREDCFVGGYRVEKGTRLLVNIWKLHRDPKIW 417 >ref|XP_002883585.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata] gi|297329425|gb|EFH59844.1| CYP82G1 [Arabidopsis lyrata subsp. lyrata] Length = 496 Score = 88.6 bits (218), Expect = 1e-15 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = +1 Query: 595 EAIVKETLRLYPPAPLSGPREAIEDCYVGKFFVSKGTHLIVNLWKLHRDPRIW 753 +AIVKET RLYPPAPL+G REA EDC+VG + V KGT L+VN+WKLHRDP+IW Sbjct: 365 QAIVKETHRLYPPAPLTGIREAREDCFVGGYRVEKGTRLLVNIWKLHRDPKIW 417