BLASTX nr result
ID: Cephaelis21_contig00038874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038874 (516 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632460.1| PREDICTED: uncharacterized protein LOC100253... 100 2e-19 emb|CBI40970.3| unnamed protein product [Vitis vinifera] 100 2e-19 ref|XP_002522356.1| conserved hypothetical protein [Ricinus comm... 100 2e-19 gb|ACY30439.1| hypothetical protein [Nicotiana tabacum] 99 3e-19 ref|XP_003611836.1| Peroxidase A [Medicago truncatula] gi|355513... 98 6e-19 >ref|XP_003632460.1| PREDICTED: uncharacterized protein LOC100253561, partial [Vitis vinifera] Length = 294 Score = 99.8 bits (247), Expect = 2e-19 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -2 Query: 152 TNDKTPATYSSKWADLHPDSQKFLRQIEERILEYRDESQRLDQCSRLYDS 3 TNDK PATYS+KWADLHPDSQKFL QIEERILEYRDESQRLDQC RLYDS Sbjct: 72 TNDKAPATYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCGRLYDS 121 >emb|CBI40970.3| unnamed protein product [Vitis vinifera] Length = 307 Score = 99.8 bits (247), Expect = 2e-19 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -2 Query: 152 TNDKTPATYSSKWADLHPDSQKFLRQIEERILEYRDESQRLDQCSRLYDS 3 TNDK PATYS+KWADLHPDSQKFL QIEERILEYRDESQRLDQC RLYDS Sbjct: 72 TNDKAPATYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCGRLYDS 121 >ref|XP_002522356.1| conserved hypothetical protein [Ricinus communis] gi|223538434|gb|EEF40040.1| conserved hypothetical protein [Ricinus communis] Length = 412 Score = 99.8 bits (247), Expect = 2e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -2 Query: 152 TNDKTPATYSSKWADLHPDSQKFLRQIEERILEYRDESQRLDQCSRLYDS 3 TNDK PA+YS+KWADLHPDSQKFL QIEERILEYRDESQRLDQCSRLYDS Sbjct: 68 TNDKAPASYSTKWADLHPDSQKFLLQIEERILEYRDESQRLDQCSRLYDS 117 >gb|ACY30439.1| hypothetical protein [Nicotiana tabacum] Length = 515 Score = 99.4 bits (246), Expect = 3e-19 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -2 Query: 152 TNDKTPATYSSKWADLHPDSQKFLRQIEERILEYRDESQRLDQCSRLYDS 3 TNDKTPATYS+KWADLHPDSQK L QIEERILEYRD+SQRLDQCSRLYDS Sbjct: 179 TNDKTPATYSTKWADLHPDSQKLLLQIEERILEYRDKSQRLDQCSRLYDS 228 >ref|XP_003611836.1| Peroxidase A [Medicago truncatula] gi|355513171|gb|AES94794.1| Peroxidase A [Medicago truncatula] Length = 489 Score = 98.2 bits (243), Expect = 6e-19 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -2 Query: 152 TNDKTPATYSSKWADLHPDSQKFLRQIEERILEYRDESQRLDQCSRLYDS 3 TNDKTPA+YS+ WADLHPDSQKFL QIEER+LEYRDESQRLDQC+RLYDS Sbjct: 68 TNDKTPASYSTNWADLHPDSQKFLLQIEERVLEYRDESQRLDQCNRLYDS 117