BLASTX nr result
ID: Cephaelis21_contig00038834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038834 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280608.2| PREDICTED: phosphate transporter PHO1 homolo... 115 3e-24 ref|XP_003631230.1| PREDICTED: phosphate transporter PHO1 homolo... 115 3e-24 ref|XP_002514517.1| xenotropic and polytropic murine leukemia vi... 113 2e-23 ref|XP_003518827.1| PREDICTED: phosphate transporter PHO1 homolo... 110 9e-23 ref|XP_003518826.1| PREDICTED: phosphate transporter PHO1 homolo... 110 9e-23 >ref|XP_002280608.2| PREDICTED: phosphate transporter PHO1 homolog 1 isoform 1 [Vitis vinifera] Length = 780 Score = 115 bits (289), Expect = 3e-24 Identities = 56/72 (77%), Positives = 63/72 (87%), Gaps = 1/72 (1%) Frame = +2 Query: 71 RRDGKFRSLSNRVINCQGKNLRIHIPLTNPTRTFSAITYLLWDDLVNQSSRKCGSE-SRL 247 R DGK R+LS RV NCQGKNLRI+IPLT P+RT SAI+YL+W DLVNQSSRKCG E S+L Sbjct: 223 REDGKLRTLSGRVFNCQGKNLRINIPLTTPSRTLSAISYLVWGDLVNQSSRKCGPEGSKL 282 Query: 248 HINKTKLHHAEK 283 +INKTKLHHAEK Sbjct: 283 NINKTKLHHAEK 294 >ref|XP_003631230.1| PREDICTED: phosphate transporter PHO1 homolog 1 isoform 2 [Vitis vinifera] gi|297737904|emb|CBI27105.3| unnamed protein product [Vitis vinifera] Length = 790 Score = 115 bits (289), Expect = 3e-24 Identities = 56/72 (77%), Positives = 63/72 (87%), Gaps = 1/72 (1%) Frame = +2 Query: 71 RRDGKFRSLSNRVINCQGKNLRIHIPLTNPTRTFSAITYLLWDDLVNQSSRKCGSE-SRL 247 R DGK R+LS RV NCQGKNLRI+IPLT P+RT SAI+YL+W DLVNQSSRKCG E S+L Sbjct: 223 REDGKLRTLSGRVFNCQGKNLRINIPLTTPSRTLSAISYLVWGDLVNQSSRKCGPEGSKL 282 Query: 248 HINKTKLHHAEK 283 +INKTKLHHAEK Sbjct: 283 NINKTKLHHAEK 294 >ref|XP_002514517.1| xenotropic and polytropic murine leukemia virus receptor pho1, putative [Ricinus communis] gi|223546121|gb|EEF47623.1| xenotropic and polytropic murine leukemia virus receptor pho1, putative [Ricinus communis] Length = 760 Score = 113 bits (282), Expect = 2e-23 Identities = 55/72 (76%), Positives = 62/72 (86%), Gaps = 1/72 (1%) Frame = +2 Query: 71 RRDGKFRSLSNRVINCQGKNLRIHIPLTNPTRTFSAITYLLWDDLVNQSSRKCG-SESRL 247 R + K RSLS RV N QGKNL+I+IPLT P+RTFSAI+YLLW+DLVNQSS+KC ESRL Sbjct: 193 REESKLRSLSGRVFNFQGKNLKINIPLTTPSRTFSAISYLLWEDLVNQSSKKCNPEESRL 252 Query: 248 HINKTKLHHAEK 283 HINKTKLHHAEK Sbjct: 253 HINKTKLHHAEK 264 >ref|XP_003518827.1| PREDICTED: phosphate transporter PHO1 homolog 1-like isoform 2 [Glycine max] Length = 797 Score = 110 bits (276), Expect = 9e-23 Identities = 53/73 (72%), Positives = 62/73 (84%), Gaps = 2/73 (2%) Frame = +2 Query: 71 RRDGKFRSLSNRVINCQGKNLRIHIPLTNPTRTFSAITYLLWDDLVNQSSRKCGSE--SR 244 R DGK R+LS RVINCQGKNLRI+IPLT P+RTFSAI+YLL +D +NQSSRKCG E + Sbjct: 221 REDGKLRTLSGRVINCQGKNLRINIPLTTPSRTFSAISYLLREDFLNQSSRKCGPEGANN 280 Query: 245 LHINKTKLHHAEK 283 +H+NKT LHHAEK Sbjct: 281 IHLNKTNLHHAEK 293 >ref|XP_003518826.1| PREDICTED: phosphate transporter PHO1 homolog 1-like isoform 1 [Glycine max] Length = 789 Score = 110 bits (276), Expect = 9e-23 Identities = 53/73 (72%), Positives = 62/73 (84%), Gaps = 2/73 (2%) Frame = +2 Query: 71 RRDGKFRSLSNRVINCQGKNLRIHIPLTNPTRTFSAITYLLWDDLVNQSSRKCGSE--SR 244 R DGK R+LS RVINCQGKNLRI+IPLT P+RTFSAI+YLL +D +NQSSRKCG E + Sbjct: 221 REDGKLRTLSGRVINCQGKNLRINIPLTTPSRTFSAISYLLREDFLNQSSRKCGPEGANN 280 Query: 245 LHINKTKLHHAEK 283 +H+NKT LHHAEK Sbjct: 281 IHLNKTNLHHAEK 293