BLASTX nr result
ID: Cephaelis21_contig00038821
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038821 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511782.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002511782.1| conserved hypothetical protein [Ricinus communis] gi|223548962|gb|EEF50451.1| conserved hypothetical protein [Ricinus communis] Length = 446 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = -3 Query: 126 TEVRFVLQKKNLLSLFNERVKNLSEKLLTIDGHLESEVTFSD 1 T+ +F+LQKK LLSL++++VK L +KLLT+DG ESEV+F D Sbjct: 22 TKDKFILQKKKLLSLYDDKVKGLMKKLLTLDGDSESEVSFED 63