BLASTX nr result
ID: Cephaelis21_contig00038777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038777 (611 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528283.1| pentatricopeptide repeat-containing protein,... 85 1e-14 emb|CBI37903.3| unnamed protein product [Vitis vinifera] 77 2e-12 ref|XP_002277549.1| PREDICTED: pentatricopeptide repeat-containi... 77 2e-12 ref|XP_004172296.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_004137053.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 >ref|XP_002528283.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532320|gb|EEF34121.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 602 Score = 84.7 bits (208), Expect = 1e-14 Identities = 40/67 (59%), Positives = 53/67 (79%) Frame = -1 Query: 206 PCIVRNFLNLCSEGHLQEAINSLDLLAQKGIRLDSQALAFLLLKCGDLKDHRLGKWVHYH 27 PCIV++ L+L S+G L +AI+SL LL++ GIRL S+ LA+LL +C + K +LGKWVH H Sbjct: 16 PCIVKSLLHLSSQGQLFQAISSLGLLSRNGIRLPSKTLAYLLQQCANTKSLKLGKWVHLH 75 Query: 26 LKVTGLK 6 LKVTGLK Sbjct: 76 LKVTGLK 82 >emb|CBI37903.3| unnamed protein product [Vitis vinifera] Length = 516 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/73 (50%), Positives = 50/73 (68%) Frame = -1 Query: 224 RPPSKNPCIVRNFLNLCSEGHLQEAINSLDLLAQKGIRLDSQALAFLLLKCGDLKDHRLG 45 R P + PC+V + LC + L EA++SL+ LA++G+RLDS+ LA LL C D + R G Sbjct: 19 RKPRRRPCLVEAIVKLCKKNKLNEAVSSLENLARRGLRLDSRTLASLLQHCADSRALREG 78 Query: 44 KWVHYHLKVTGLK 6 K VH HLK+TGLK Sbjct: 79 KRVHLHLKLTGLK 91 >ref|XP_002277549.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090 [Vitis vinifera] Length = 612 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/73 (50%), Positives = 50/73 (68%) Frame = -1 Query: 224 RPPSKNPCIVRNFLNLCSEGHLQEAINSLDLLAQKGIRLDSQALAFLLLKCGDLKDHRLG 45 R P + PC+V + LC + L EA++SL+ LA++G+RLDS+ LA LL C D + R G Sbjct: 19 RKPRRRPCLVEAIVKLCKKNKLNEAVSSLENLARRGLRLDSRTLASLLQHCADSRALREG 78 Query: 44 KWVHYHLKVTGLK 6 K VH HLK+TGLK Sbjct: 79 KRVHLHLKLTGLK 91 >ref|XP_004172296.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like [Cucumis sativus] Length = 611 Score = 67.8 bits (164), Expect = 1e-09 Identities = 44/101 (43%), Positives = 56/101 (55%) Frame = -1 Query: 308 MPSFFSRTRILESNIKLRTNNGNKSRLVRPPSKNPCIVRNFLNLCSEGHLQEAINSLDLL 129 MPSF S+ K + G KS+ RP S CI ++ L+L S+G L EA++ LD L Sbjct: 1 MPSFSSQA------FKTPASFGPKSKQ-RPDSTGLCIAQSLLDLSSQGRLPEALSYLDRL 53 Query: 128 AQKGIRLDSQALAFLLLKCGDLKDHRLGKWVHYHLKVTGLK 6 AQ+GIRL + LL C K + GK VH HLK TG K Sbjct: 54 AQRGIRLPTGIFVDLLRLCAKAKYFKGGKCVHLHLKHTGFK 94 >ref|XP_004137053.1| PREDICTED: pentatricopeptide repeat-containing protein At2g21090-like [Cucumis sativus] Length = 611 Score = 67.8 bits (164), Expect = 1e-09 Identities = 43/101 (42%), Positives = 57/101 (56%) Frame = -1 Query: 308 MPSFFSRTRILESNIKLRTNNGNKSRLVRPPSKNPCIVRNFLNLCSEGHLQEAINSLDLL 129 MPSF S+ K + G KS+ RP S + CI ++ L+L S+G L EA++ LD L Sbjct: 1 MPSFSSQA------FKTPASFGPKSKQ-RPDSTSLCIAQSLLDLSSQGRLPEALSYLDRL 53 Query: 128 AQKGIRLDSQALAFLLLKCGDLKDHRLGKWVHYHLKVTGLK 6 AQ+G+RL + LL C K + GK VH HLK TG K Sbjct: 54 AQRGVRLPTGIFVDLLRLCAKAKYFKGGKCVHLHLKHTGFK 94