BLASTX nr result
ID: Cephaelis21_contig00038685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038685 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004172504.1| PREDICTED: small heat shock protein, chlorop... 60 1e-07 ref|XP_004147204.1| PREDICTED: small heat shock protein, chlorop... 59 4e-07 ref|XP_004172503.1| PREDICTED: small heat shock protein, chlorop... 58 9e-07 ref|XP_002528933.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 gb|AAF37726.1|AF237957_1 LMW heat shock protein [Euphorbia esula] 57 2e-06 >ref|XP_004172504.1| PREDICTED: small heat shock protein, chloroplastic-like [Cucumis sativus] Length = 209 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/72 (34%), Positives = 48/72 (66%) Frame = -2 Query: 266 LYVRVDMPGVEDDEAKVTWDEKKVCFVGEAPKQTELEAEDRSYKGELDFTTDPVQIHDVK 87 LY+R+DMPG+ D+ KV+ ++ + GEA K++E E + R + LD + +++ +K Sbjct: 121 LYLRMDMPGLSKDDVKVSVEQNTLIIKGEAEKESEDEEDRRRFSSRLDLPANLYELNSIK 180 Query: 86 SDLKNGVLRMVL 51 +++KNGVL++ + Sbjct: 181 AEMKNGVLKVAV 192 >ref|XP_004147204.1| PREDICTED: small heat shock protein, chloroplastic-like [Cucumis sativus] Length = 213 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/72 (34%), Positives = 48/72 (66%) Frame = -2 Query: 266 LYVRVDMPGVEDDEAKVTWDEKKVCFVGEAPKQTELEAEDRSYKGELDFTTDPVQIHDVK 87 LY+R+DMPG+ D+ KV+ ++ + GEA K++E E + R + LD + +++ +K Sbjct: 125 LYLRMDMPGLGKDDVKVSVEQNTLIIKGEAEKESEDEEDLRRFSSRLDLPANLYELNSIK 184 Query: 86 SDLKNGVLRMVL 51 +++KNGVL++ + Sbjct: 185 AEMKNGVLKVAV 196 >ref|XP_004172503.1| PREDICTED: small heat shock protein, chloroplastic-like [Cucumis sativus] Length = 212 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/72 (31%), Positives = 47/72 (65%) Frame = -2 Query: 266 LYVRVDMPGVEDDEAKVTWDEKKVCFVGEAPKQTELEAEDRSYKGELDFTTDPVQIHDVK 87 LY+R+DMPG+ D+ +V+ ++ + GE K++E E + R + LD + +++ +K Sbjct: 124 LYLRMDMPGLSKDDVRVSVEQNTLIIKGEGAKESEDEEDRRRFSSRLDLPANLYELNSIK 183 Query: 86 SDLKNGVLRMVL 51 +++KNGVL++ + Sbjct: 184 AEMKNGVLKVAV 195 >ref|XP_002528933.1| conserved hypothetical protein [Ricinus communis] gi|223531635|gb|EEF33462.1| conserved hypothetical protein [Ricinus communis] Length = 133 Score = 57.8 bits (138), Expect = 9e-07 Identities = 31/74 (41%), Positives = 48/74 (64%), Gaps = 2/74 (2%) Frame = -2 Query: 266 LYVRVDMPGVEDDEAKVTWDEKKVC--FVGEAPKQTELEAEDRSYKGELDFTTDPVQIHD 93 LY+R+D PGV + + D++K C F GEAP Q++ + DRSY +L F +I + Sbjct: 45 LYMRIDFPGVPKQNLRFSIDQEKKCVTFEGEAPPQSQHDGGDRSYVYDL-FRCSCCKISN 103 Query: 92 VKSDLKNGVLRMVL 51 VK+D+K+GV R++L Sbjct: 104 VKADVKDGVARIIL 117 >gb|AAF37726.1|AF237957_1 LMW heat shock protein [Euphorbia esula] Length = 204 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/72 (34%), Positives = 45/72 (62%) Frame = -2 Query: 266 LYVRVDMPGVEDDEAKVTWDEKKVCFVGEAPKQTELEAEDRSYKGELDFTTDPVQIHDVK 87 L +RVDMPG++ + KV+ ++ + GE K++E E R Y G +D + ++K Sbjct: 116 LNLRVDMPGLDKKDVKVSVEKNTLIIKGEGEKESEDEESGRKYSGRIDLPEKMFKTDEIK 175 Query: 86 SDLKNGVLRMVL 51 +++KNGVL++V+ Sbjct: 176 AEMKNGVLKVVV 187