BLASTX nr result
ID: Cephaelis21_contig00038676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038676 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_16593857.1| hypothetical protein HMPREF9574_00607 [Propio... 130 9e-29 ref|ZP_02043165.1| hypothetical protein ACTODO_00002 [Actinomyce... 126 2e-27 ref|ZP_06910887.1| conserved hypothetical protein [Streptomyces ... 124 6e-27 ref|ZP_06708712.1| conserved hypothetical protein [Streptomyces ... 124 6e-27 ref|ZP_05003849.1| conserved hypothetical protein [Streptomyces ... 124 6e-27 >ref|ZP_16593857.1| hypothetical protein HMPREF9574_00607 [Propionibacterium acnes HL074PA1] gi|313773062|gb|EFS39028.1| hypothetical protein HMPREF9574_00607 [Propionibacterium acnes HL074PA1] Length = 105 Score = 130 bits (328), Expect = 9e-29 Identities = 59/59 (100%), Positives = 59/59 (100%) Frame = -3 Query: 226 KSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRRSATLR 50 KSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRRSATLR Sbjct: 47 KSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRRSATLR 105 >ref|ZP_02043165.1| hypothetical protein ACTODO_00002 [Actinomyces odontolyticus ATCC 17982] gi|153799348|gb|EDN81768.1| hypothetical protein ACTODO_00002 [Actinomyces odontolyticus ATCC 17982] Length = 89 Score = 126 bits (316), Expect = 2e-27 Identities = 62/76 (81%), Positives = 64/76 (84%) Frame = -1 Query: 228 SSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDLMKSESLVIADQQRCG 49 S+HHAPYV GFTHATMAGTE + VR SES KA LSSDWGLQLD MK ESLVIADQQRCG Sbjct: 13 SNHHAPYVLGFTHATMAGTEGCDTVRWSESLKASLSSDWGLQLDPMKVESLVIADQQRCG 72 Query: 48 EYVPGACTHRPSSHES 1 EYV G CTHRPS HES Sbjct: 73 EYVLGPCTHRPSRHES 88 >ref|ZP_06910887.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] gi|297151805|gb|EDY62143.2| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 95 Score = 124 bits (312), Expect = 6e-27 Identities = 62/76 (81%), Positives = 64/76 (84%) Frame = -1 Query: 228 SSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDLMKSESLVIADQQRCG 49 SSHHAPYV G T ATMAGT+S E VR SES+KAGLSSDWGLQLD MKSE LVIADQ CG Sbjct: 19 SSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLDPMKSELLVIADQHCCG 78 Query: 48 EYVPGACTHRPSSHES 1 EYVPG CTHRPS HES Sbjct: 79 EYVPGPCTHRPSRHES 94 >ref|ZP_06708712.1| conserved hypothetical protein [Streptomyces sp. e14] gi|292833485|gb|EFF91834.1| conserved hypothetical protein [Streptomyces sp. e14] Length = 95 Score = 124 bits (312), Expect = 6e-27 Identities = 62/76 (81%), Positives = 64/76 (84%) Frame = -1 Query: 228 SSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDLMKSESLVIADQQRCG 49 SSHHAPYV G T ATMAGT S + VR SES+KAGLSSDWGLQLD MKSESLVIADQ CG Sbjct: 19 SSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSESLVIADQHCCG 78 Query: 48 EYVPGACTHRPSSHES 1 EYVPG CTHRPS HES Sbjct: 79 EYVPGPCTHRPSRHES 94 >ref|ZP_05003849.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] gi|197702336|gb|EDY48148.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] Length = 95 Score = 124 bits (312), Expect = 6e-27 Identities = 62/76 (81%), Positives = 64/76 (84%) Frame = -1 Query: 228 SSHHAPYVQGFTHATMAGTESGEPVRVSESRKAGLSSDWGLQLDLMKSESLVIADQQRCG 49 SSHHAPYV G T ATMAGT+S E VR SES+KAGLSSDWGLQLD MKSE LVIADQ CG Sbjct: 19 SSHHAPYVLGCTRATMAGTKSCETVRWSESQKAGLSSDWGLQLDPMKSELLVIADQHCCG 78 Query: 48 EYVPGACTHRPSSHES 1 EYVPG CTHRPS HES Sbjct: 79 EYVPGPCTHRPSRHES 94