BLASTX nr result
ID: Cephaelis21_contig00038630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038630 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630994.1| hypothetical protein MTR_8g105950 [Medicago ... 56 3e-06 >ref|XP_003630994.1| hypothetical protein MTR_8g105950 [Medicago truncatula] gi|355525016|gb|AET05470.1| hypothetical protein MTR_8g105950 [Medicago truncatula] Length = 245 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/58 (41%), Positives = 33/58 (56%) Frame = -3 Query: 232 IRHLCKRDWICKCKHVYREANRVADLLAGSGRNQDSPLNVLEDPPPQALELLTRDRVG 59 I+HL +RDW+ +H +RE N V D LA G DS L +L + PP +L D +G Sbjct: 184 IKHLLRRDWVVSLRHTFREGNVVVDFLAKEGALSDSSLVILNEAPPNITSVLLADAIG 241