BLASTX nr result
ID: Cephaelis21_contig00038549
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038549 (392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_196765.2| omega-amidase [Arabidopsis thaliana] gi|1971557... 55 8e-06 emb|CAB87677.1| putative protein [Arabidopsis thaliana] 55 8e-06 >ref|NP_196765.2| omega-amidase [Arabidopsis thaliana] gi|19715574|gb|AAL91613.1| AT5g12040/F14F18_210 [Arabidopsis thaliana] gi|20147243|gb|AAM10335.1| AT5g12040/F14F18_210 [Arabidopsis thaliana] gi|332004371|gb|AED91754.1| omega-amidase [Arabidopsis thaliana] Length = 369 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = +3 Query: 3 IIATTGHEATMLIADIDYSTNRQTRESLPLERQRREDVYKFIDLDQ 140 ++ATT HE ++IA+IDYS Q R SLPL RQRR D+Y+ +D+ + Sbjct: 320 VLATTEHEEAIIIAEIDYSILEQRRTSLPLNRQRRGDLYQLVDVQR 365 >emb|CAB87677.1| putative protein [Arabidopsis thaliana] Length = 318 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = +3 Query: 3 IIATTGHEATMLIADIDYSTNRQTRESLPLERQRREDVYKFIDLDQ 140 ++ATT HE ++IA+IDYS Q R SLPL RQRR D+Y+ +D+ + Sbjct: 269 VLATTEHEEAIIIAEIDYSILEQRRTSLPLNRQRRGDLYQLVDVQR 314