BLASTX nr result
ID: Cephaelis21_contig00038513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038513 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269519.1| PREDICTED: F-box protein SKIP5 [Vitis vinife... 83 3e-14 ref|XP_002513076.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 gb|AFK39958.1| unknown [Medicago truncatula] 77 2e-12 ref|XP_003598632.1| F-box protein SKIP5 [Medicago truncatula] gi... 77 2e-12 ref|XP_003598631.1| F-box protein SKIP5 [Medicago truncatula] gi... 77 2e-12 >ref|XP_002269519.1| PREDICTED: F-box protein SKIP5 [Vitis vinifera] gi|297742690|emb|CBI35143.3| unnamed protein product [Vitis vinifera] Length = 254 Score = 82.8 bits (203), Expect = 3e-14 Identities = 38/48 (79%), Positives = 45/48 (93%) Frame = +1 Query: 1 HGDAVFVSRTRIEGGAKAVLTNGSLSLQEVRVIYSRTSVFFWFDVEHR 144 HGD+V VSRTRIEGGAKAV+T+GSL+LQ VRVIY+RTS+FFWFDV+ R Sbjct: 207 HGDSVSVSRTRIEGGAKAVVTSGSLALQRVRVIYARTSIFFWFDVDRR 254 >ref|XP_002513076.1| conserved hypothetical protein [Ricinus communis] gi|223548087|gb|EEF49579.1| conserved hypothetical protein [Ricinus communis] Length = 250 Score = 77.4 bits (189), Expect = 1e-12 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = +1 Query: 1 HGDAVFVSRTRIEGGAKAVLTNGSLSLQEVRVIYSRTSVFFWFDVEHR 144 +GD+V VS+TRIEGGAKAVLTNG L LQ VRVIYSRT V+FWFDV H+ Sbjct: 203 NGDSVTVSQTRIEGGAKAVLTNGDLVLQRVRVIYSRTYVYFWFDVGHK 250 >gb|AFK39958.1| unknown [Medicago truncatula] Length = 141 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +1 Query: 1 HGDAVFVSRTRIEGGAKAVLTNGSLSLQEVRVIYSRTSVFFWFDVE 138 +GD VFVS+TRIEGGAKAVLT+G L+LQ VRV+Y+RTS+ FWFDVE Sbjct: 94 NGDGVFVSQTRIEGGAKAVLTSGDLALQRVRVVYARTSLLFWFDVE 139 >ref|XP_003598632.1| F-box protein SKIP5 [Medicago truncatula] gi|355487680|gb|AES68883.1| F-box protein SKIP5 [Medicago truncatula] Length = 141 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +1 Query: 1 HGDAVFVSRTRIEGGAKAVLTNGSLSLQEVRVIYSRTSVFFWFDVE 138 +GD VFVS+TRIEGGAKAVLT+G L+LQ VRV+Y+RTS+ FWFDVE Sbjct: 94 NGDGVFVSQTRIEGGAKAVLTSGDLALQRVRVVYARTSLLFWFDVE 139 >ref|XP_003598631.1| F-box protein SKIP5 [Medicago truncatula] gi|355487679|gb|AES68882.1| F-box protein SKIP5 [Medicago truncatula] Length = 260 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +1 Query: 1 HGDAVFVSRTRIEGGAKAVLTNGSLSLQEVRVIYSRTSVFFWFDVE 138 +GD VFVS+TRIEGGAKAVLT+G L+LQ VRV+Y+RTS+ FWFDVE Sbjct: 213 NGDGVFVSQTRIEGGAKAVLTSGDLALQRVRVVYARTSLLFWFDVE 258