BLASTX nr result
ID: Cephaelis21_contig00038481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038481 (585 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285483.2| PREDICTED: auxin-responsive protein IAA13-li... 75 6e-12 emb|CBI23724.3| unnamed protein product [Vitis vinifera] 75 6e-12 ref|XP_002285481.1| PREDICTED: auxin-responsive protein IAA13-li... 75 6e-12 gb|AFP54302.1| ARF domain class transcription factor [Pyrus x br... 73 3e-11 gb|ADL36583.1| ARF domain class transcription factor [Malus x do... 73 3e-11 >ref|XP_002285483.2| PREDICTED: auxin-responsive protein IAA13-like isoform 2 [Vitis vinifera] Length = 321 Score = 75.5 bits (184), Expect = 6e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 2 VGDVPWGMFLCTVKRLKIMRNSEANGIAPTFQQRHERQKGKPI 130 VGDVPWGMFL TVKRL+IMR SEANG+AP FQ+R ERQ+ KPI Sbjct: 279 VGDVPWGMFLSTVKRLRIMRTSEANGLAPRFQERSERQRSKPI 321 >emb|CBI23724.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 75.5 bits (184), Expect = 6e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 2 VGDVPWGMFLCTVKRLKIMRNSEANGIAPTFQQRHERQKGKPI 130 VGDVPWGMFL TVKRL+IMR SEANG+AP FQ+R ERQ+ KPI Sbjct: 241 VGDVPWGMFLSTVKRLRIMRTSEANGLAPRFQERSERQRSKPI 283 >ref|XP_002285481.1| PREDICTED: auxin-responsive protein IAA13-like isoform 1 [Vitis vinifera] Length = 314 Score = 75.5 bits (184), Expect = 6e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 2 VGDVPWGMFLCTVKRLKIMRNSEANGIAPTFQQRHERQKGKPI 130 VGDVPWGMFL TVKRL+IMR SEANG+AP FQ+R ERQ+ KPI Sbjct: 272 VGDVPWGMFLSTVKRLRIMRTSEANGLAPRFQERSERQRSKPI 314 >gb|AFP54302.1| ARF domain class transcription factor [Pyrus x bretschneideri] Length = 306 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +2 Query: 2 VGDVPWGMFLCTVKRLKIMRNSEANGIAPTFQQRHERQKGKPI 130 VGDVPWGMFL +VKRL+IMR SEANG+AP FQ+R ERQ+ KPI Sbjct: 264 VGDVPWGMFLGSVKRLRIMRTSEANGLAPRFQERSERQRNKPI 306 >gb|ADL36583.1| ARF domain class transcription factor [Malus x domestica] Length = 306 Score = 73.2 bits (178), Expect = 3e-11 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = +2 Query: 2 VGDVPWGMFLCTVKRLKIMRNSEANGIAPTFQQRHERQKGKPI 130 VGDVPWGMFL +VKRL+IMR SEANG+AP FQ+R ERQ+ KPI Sbjct: 264 VGDVPWGMFLGSVKRLRIMRTSEANGLAPRFQERSERQRNKPI 306