BLASTX nr result
ID: Cephaelis21_contig00038469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038469 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518756.1| conserved hypothetical protein [Ricinus comm... 52 5e-07 ref|XP_003607957.1| Protein thiJ [Medicago truncatula] gi|355509... 46 2e-06 ref|XP_004136975.1| PREDICTED: uncharacterized protein LOC101204... 49 5e-06 >ref|XP_002518756.1| conserved hypothetical protein [Ricinus communis] gi|223542137|gb|EEF43681.1| conserved hypothetical protein [Ricinus communis] Length = 477 Score = 52.0 bits (123), Expect(2) = 5e-07 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = -3 Query: 128 LLRRKQTNCHPALIYKLPTFWAVKLNHHAFGDLT 27 LL+RKQT CHPA + KLPTFWAVK N G+LT Sbjct: 203 LLKRKQTTCHPAFMDKLPTFWAVKSNIQVSGELT 236 Score = 26.6 bits (57), Expect(2) = 5e-07 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -2 Query: 237 KFCVMVAKPQIFRDRFMGAVNVAPTIALAVTLLPWG 130 K + Q R GA+ AP AVTLLPWG Sbjct: 171 KILQQITSKQAEEKRLYGAICSAP----AVTLLPWG 202 >ref|XP_003607957.1| Protein thiJ [Medicago truncatula] gi|355509012|gb|AES90154.1| Protein thiJ [Medicago truncatula] Length = 451 Score = 46.2 bits (108), Expect(2) = 2e-06 Identities = 20/34 (58%), Positives = 23/34 (67%) Frame = -3 Query: 128 LLRRKQTNCHPALIYKLPTFWAVKLNHHAFGDLT 27 LL+RK+ CHPA +KLPTFWAVK N LT Sbjct: 176 LLKRKKITCHPAFFHKLPTFWAVKSNIQVSNGLT 209 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 15/27 (55%), Positives = 17/27 (62%) Frame = -2 Query: 210 QIFRDRFMGAVNVAPTIALAVTLLPWG 130 Q +R GA+N AP AVTLLPWG Sbjct: 153 QAEENRLFGAINAAP----AVTLLPWG 175 >ref|XP_004136975.1| PREDICTED: uncharacterized protein LOC101204195 [Cucumis sativus] gi|449495608|ref|XP_004159893.1| PREDICTED: uncharacterized protein LOC101229677 [Cucumis sativus] Length = 473 Score = 48.9 bits (115), Expect(2) = 5e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -3 Query: 128 LLRRKQTNCHPALIYKLPTFWAVKLNHHAFGDLT 27 LLRRKQT CHPA KLPTFWAV+ + G+LT Sbjct: 200 LLRRKQTTCHPAFTDKLPTFWAVQSSIQVSGELT 233 Score = 26.2 bits (56), Expect(2) = 5e-06 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 Query: 222 VAKPQIFRDRFMGAVNVAPTIALAVTLLPWG 130 + Q R GA+ AP AVTLLPWG Sbjct: 173 ITSRQAEEKRLYGAICAAP----AVTLLPWG 199