BLASTX nr result
ID: Cephaelis21_contig00038460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038460 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272799.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 emb|CBI24637.3| unnamed protein product [Vitis vinifera] 102 4e-20 emb|CAN65295.1| hypothetical protein VITISV_017782 [Vitis vinifera] 102 4e-20 ref|XP_002530303.1| ATP binding protein, putative [Ricinus commu... 91 7e-17 ref|XP_004152311.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-16 >ref|XP_002272799.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Vitis vinifera] Length = 237 Score = 102 bits (253), Expect = 4e-20 Identities = 56/84 (66%), Positives = 64/84 (76%) Frame = +1 Query: 151 PNSPVPFTLKITCGLRKIGPRKPLWRSRVLSPEAIRAVHSLKLAKSPDKLADVFRSTISR 330 P + P KI CGLR GPRKPLWRSRVLS EAI+ V SLKLAKS KL +VF S +SR Sbjct: 17 PQTHKPQFPKIACGLRG-GPRKPLWRSRVLSTEAIQVVQSLKLAKSSIKLEEVFSSRVSR 75 Query: 331 LLKADLLDALSELQRQNELELALQ 402 LLK+DLLD L+ELQRQ EL+L L+ Sbjct: 76 LLKSDLLDTLAELQRQGELDLTLK 99 >emb|CBI24637.3| unnamed protein product [Vitis vinifera] Length = 242 Score = 102 bits (253), Expect = 4e-20 Identities = 56/84 (66%), Positives = 64/84 (76%) Frame = +1 Query: 151 PNSPVPFTLKITCGLRKIGPRKPLWRSRVLSPEAIRAVHSLKLAKSPDKLADVFRSTISR 330 P + P KI CGLR GPRKPLWRSRVLS EAI+ V SLKLAKS KL +VF S +SR Sbjct: 22 PQTHKPQFPKIACGLRG-GPRKPLWRSRVLSTEAIQVVQSLKLAKSSIKLEEVFSSRVSR 80 Query: 331 LLKADLLDALSELQRQNELELALQ 402 LLK+DLLD L+ELQRQ EL+L L+ Sbjct: 81 LLKSDLLDTLAELQRQGELDLTLK 104 >emb|CAN65295.1| hypothetical protein VITISV_017782 [Vitis vinifera] Length = 303 Score = 102 bits (253), Expect = 4e-20 Identities = 56/84 (66%), Positives = 64/84 (76%) Frame = +1 Query: 151 PNSPVPFTLKITCGLRKIGPRKPLWRSRVLSPEAIRAVHSLKLAKSPDKLADVFRSTISR 330 P + P KI CGLR GPRKPLWRSRVLS EAI+ V SLKLAKS KL +VF S +SR Sbjct: 17 PQTHKPQFPKIACGLRG-GPRKPLWRSRVLSTEAIQVVQSLKLAKSSIKLEEVFSSRVSR 75 Query: 331 LLKADLLDALSELQRQNELELALQ 402 LLK+DLLD L+ELQRQ EL+L L+ Sbjct: 76 LLKSDLLDTLAELQRQGELDLTLK 99 >ref|XP_002530303.1| ATP binding protein, putative [Ricinus communis] gi|223530159|gb|EEF32070.1| ATP binding protein, putative [Ricinus communis] Length = 244 Score = 91.3 bits (225), Expect = 7e-17 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 2/94 (2%) Frame = +1 Query: 127 PPKFKIC-LPNSPVPFTLKITCGLRKIGPRKPLWRSRVLSPEAIRAVHSLKLAKSPD-KL 300 PP +I +P +P T +TC LR GPRKPLWRS+ +S EAI+A+ SLKLAKS + +L Sbjct: 11 PPPLRIFQIPKTPNFKTSFVTCSLRG-GPRKPLWRSKRVSTEAIQAIQSLKLAKSSNPRL 69 Query: 301 ADVFRSTISRLLKADLLDALSELQRQNELELALQ 402 VF + +SRLLK DLLD L LQ+QNEL+LAL+ Sbjct: 70 HQVFNTKLSRLLKTDLLDVLEILQKQNELDLALK 103 >ref|XP_004152311.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Cucumis sativus] gi|449484870|ref|XP_004157003.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Cucumis sativus] Length = 245 Score = 90.9 bits (224), Expect = 1e-16 Identities = 54/86 (62%), Positives = 61/86 (70%) Frame = +1 Query: 145 CLPNSPVPFTLKITCGLRKIGPRKPLWRSRVLSPEAIRAVHSLKLAKSPDKLADVFRSTI 324 C +P P I CGLRK G +PL SRV S EAI+AV SLKLAKS K+ DV + + Sbjct: 29 CGTAAPPP---NIICGLRK-GSNRPLGLSRVPSNEAIQAVQSLKLAKSTSKMEDVINTKL 84 Query: 325 SRLLKADLLDALSELQRQNELELALQ 402 RLLKADL DALSELQRQNELEL+LQ Sbjct: 85 GRLLKADLFDALSELQRQNELELSLQ 110