BLASTX nr result
ID: Cephaelis21_contig00038103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00038103 (468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28073.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002281015.1| PREDICTED: flavin-containing monooxygenase Y... 62 6e-08 emb|CAN60211.1| hypothetical protein VITISV_036965 [Vitis vinifera] 62 6e-08 ref|XP_002514307.1| monooxygenase, putative [Ricinus communis] g... 59 3e-07 ref|XP_002516580.1| monooxygenase, putative [Ricinus communis] g... 57 2e-06 >emb|CBI28073.3| unnamed protein product [Vitis vinifera] Length = 470 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = +1 Query: 337 MDFLKEIEGKRVHDRTPNDM-KTSRCVCVPGPVIVGAGPSGLAAA 468 MD+LKE+EGKRVHD M K+ R + VPGPVIVGAGPSGLA A Sbjct: 1 MDYLKEVEGKRVHDPLGRKMSKSERRILVPGPVIVGAGPSGLAVA 45 >ref|XP_002281015.1| PREDICTED: flavin-containing monooxygenase YUCCA2 [Vitis vinifera] Length = 422 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = +1 Query: 337 MDFLKEIEGKRVHDRTPNDM-KTSRCVCVPGPVIVGAGPSGLAAA 468 MD+LKE+EGKRVHD M K+ R + VPGPVIVGAGPSGLA A Sbjct: 1 MDYLKEVEGKRVHDPLGRKMSKSERRILVPGPVIVGAGPSGLAVA 45 >emb|CAN60211.1| hypothetical protein VITISV_036965 [Vitis vinifera] Length = 422 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/45 (68%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = +1 Query: 337 MDFLKEIEGKRVHDRTPNDM-KTSRCVCVPGPVIVGAGPSGLAAA 468 MD+LKE+EGKRVHD M K+ R + VPGPVIVGAGPSGLA A Sbjct: 1 MDYLKEVEGKRVHDPLGRKMSKSERRILVPGPVIVGAGPSGLAVA 45 >ref|XP_002514307.1| monooxygenase, putative [Ricinus communis] gi|223546763|gb|EEF48261.1| monooxygenase, putative [Ricinus communis] Length = 410 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/46 (60%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = +1 Query: 337 MDFLKEIEGKRVHDRTPNDM--KTSRCVCVPGPVIVGAGPSGLAAA 468 M+++KE+EGKR+HD +M SRC+ VPG VIVGAGPSGLAA+ Sbjct: 1 MEYMKEVEGKRIHDPFNKNMAISPSRCIWVPGAVIVGAGPSGLAAS 46 >ref|XP_002516580.1| monooxygenase, putative [Ricinus communis] gi|223544400|gb|EEF45921.1| monooxygenase, putative [Ricinus communis] Length = 435 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/52 (61%), Positives = 36/52 (69%), Gaps = 8/52 (15%) Frame = +1 Query: 337 MDF--LKEIEGKRVHD----RTPNDMKTS--RCVCVPGPVIVGAGPSGLAAA 468 MD+ L+EIEGK+ HD N K S RC+CVPGPVIVGAGPSGLA A Sbjct: 1 MDYCSLREIEGKQAHDPIFIENMNKKKISSLRCICVPGPVIVGAGPSGLAVA 52