BLASTX nr result
ID: Cephaelis21_contig00037945
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037945 (655 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550612.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-14 ref|XP_002278014.2| PREDICTED: pentatricopeptide repeat-containi... 80 3e-13 ref|XP_002512275.1| pentatricopeptide repeat-containing protein,... 75 1e-11 ref|XP_004157939.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_004141071.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 >ref|XP_003550612.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Glycine max] Length = 544 Score = 83.2 bits (204), Expect = 4e-14 Identities = 45/94 (47%), Positives = 58/94 (61%) Frame = +2 Query: 374 WFIKVVCTLSVCASEDLTVFSSDYFRRHLNPTIAFFVIQHLNYNFRNPRLAFEFFQFTRL 553 WF+K+V TL +C S L YFR HL P+ V++ N NP L F+FF+FTR Sbjct: 46 WFVKIVSTLFLC-SNSLDDRFLGYFREHLTPSHVLEVVKRFN----NPNLGFKFFRFTRE 100 Query: 554 NLSLLHSVSTFNLLLRSLCQLGFLDLAKLLIDHL 655 LS+ HS T+N+LLRSLCQ G + AKLL D + Sbjct: 101 RLSMSHSFWTYNMLLRSLCQAGLHNSAKLLYDSM 134 >ref|XP_002278014.2| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vitis vinifera] Length = 641 Score = 80.1 bits (196), Expect = 3e-13 Identities = 52/130 (40%), Positives = 73/130 (56%), Gaps = 4/130 (3%) Frame = +2 Query: 272 WIRKASRKIAFKSIARCFHGPAP-VESHLPKV---ETIWFIKVVCTLSVCASEDLTVFSS 439 +I + SR A K FH A + + P+V W +KV+CTL C Sbjct: 38 FITRPSRVRASKIAIAQFHEHAVGISRNRPEVIQNPENWIVKVICTL--CVRTHSLDACL 95 Query: 440 DYFRRHLNPTIAFFVIQHLNYNFRNPRLAFEFFQFTRLNLSLLHSVSTFNLLLRSLCQLG 619 DYF + L P+IAF V++ LN NP LA +FFQ +R+NL+L HS T++ LLRSL ++G Sbjct: 96 DYFSKTLTPSIAFEVVRGLN----NPELALKFFQLSRVNLNLCHSFRTYSFLLRSLSEMG 151 Query: 620 FLDLAKLLID 649 F + AK + D Sbjct: 152 FHESAKAVYD 161 >ref|XP_002512275.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548236|gb|EEF49727.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 532 Score = 75.1 bits (183), Expect = 1e-11 Identities = 45/112 (40%), Positives = 65/112 (58%), Gaps = 1/112 (0%) Frame = +2 Query: 323 FHGPAPVESHLPKVETIWFIKVVCTLSVCASEDLTVFSSDYFRRHLN-PTIAFFVIQHLN 499 FH P + + K + WF+KV+ L V S S Y LN P +AF VI+ LN Sbjct: 13 FH-PFSDKEVIVKNQEAWFVKVIAILFV-RSHCSDATSLGYLSEKLNDPLVAFEVIKRLN 70 Query: 500 YNFRNPRLAFEFFQFTRLNLSLLHSVSTFNLLLRSLCQLGFLDLAKLLIDHL 655 NP++ +F +F RLN SL+H ST+ LL+RSLCQ+G DL +++I ++ Sbjct: 71 ---NNPQVGLKFMEFCRLNFSLIHCFSTYELLIRSLCQMGLHDLVEMVIGYM 119 >ref|XP_004157939.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Cucumis sativus] Length = 548 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/92 (42%), Positives = 60/92 (65%) Frame = +2 Query: 374 WFIKVVCTLSVCASEDLTVFSSDYFRRHLNPTIAFFVIQHLNYNFRNPRLAFEFFQFTRL 553 W +KVVCTL + F Y R+LNP+IAF VI+ F +P L +FF+F+R Sbjct: 48 WLVKVVCTLFFRSHSLNACFG--YLSRNLNPSIAFEVIKR----FSDPLLGLKFFEFSRT 101 Query: 554 NLSLLHSVSTFNLLLRSLCQLGFLDLAKLLID 649 +LS+ H+ +T++LL+R+LC++G D AK++ D Sbjct: 102 HLSINHTFNTYDLLMRNLCKVGLNDSAKIVFD 133 >ref|XP_004141071.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Cucumis sativus] Length = 548 Score = 74.7 bits (182), Expect = 1e-11 Identities = 39/92 (42%), Positives = 60/92 (65%) Frame = +2 Query: 374 WFIKVVCTLSVCASEDLTVFSSDYFRRHLNPTIAFFVIQHLNYNFRNPRLAFEFFQFTRL 553 W +KVVCTL + F Y R+LNP+IAF VI+ F +P L +FF+F+R Sbjct: 48 WLVKVVCTLFFRSHSLNACFG--YLSRNLNPSIAFEVIKR----FSDPLLGLKFFEFSRT 101 Query: 554 NLSLLHSVSTFNLLLRSLCQLGFLDLAKLLID 649 +LS+ H+ +T++LL+R+LC++G D AK++ D Sbjct: 102 HLSINHTFNTYDLLMRNLCKVGLNDSAKIVFD 133