BLASTX nr result
ID: Cephaelis21_contig00037941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037941 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268943.1| PREDICTED: F-box/kelch-repeat protein At5g26... 82 5e-14 ref|XP_002523232.1| conserved hypothetical protein [Ricinus comm... 81 1e-13 ref|XP_002313276.1| predicted protein [Populus trichocarpa] gi|2... 79 4e-13 ref|XP_002299964.1| predicted protein [Populus trichocarpa] gi|2... 75 4e-12 ref|XP_004159361.1| PREDICTED: F-box/kelch-repeat protein At5g26... 74 9e-12 >ref|XP_002268943.1| PREDICTED: F-box/kelch-repeat protein At5g26960-like [Vitis vinifera] Length = 416 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +2 Query: 2 LRRGGRNERGLKEGLVLIYDCTTGEWSRGADLPDVIRRAACVCVMC 139 LRR GR+ RGL+EGLVLIYD GEWSRGADLP+VIRRAACVCV C Sbjct: 371 LRRSGRSTRGLREGLVLIYDAAAGEWSRGADLPEVIRRAACVCVEC 416 >ref|XP_002523232.1| conserved hypothetical protein [Ricinus communis] gi|223537528|gb|EEF39153.1| conserved hypothetical protein [Ricinus communis] Length = 420 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = +2 Query: 2 LRRGGRNERGLKEGLVLIYDCTTGEWSRGADLPDVIRRAACVCVMC 139 LRR GRN RGL+EGLVLIYDC GEWSRG DLP+VIRRAACV V C Sbjct: 375 LRRSGRNVRGLREGLVLIYDCADGEWSRGPDLPEVIRRAACVTVEC 420 >ref|XP_002313276.1| predicted protein [Populus trichocarpa] gi|222849684|gb|EEE87231.1| predicted protein [Populus trichocarpa] Length = 420 Score = 79.0 bits (193), Expect = 4e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +2 Query: 2 LRRGGRNERGLKEGLVLIYDCTTGEWSRGADLPDVIRRAACVCVMC 139 LRR GR+ RGLKEGLVLIYDC +GEWSRG DLP+VIRR ACV V C Sbjct: 375 LRRSGRSVRGLKEGLVLIYDCISGEWSRGPDLPEVIRRGACVTVEC 420 >ref|XP_002299964.1| predicted protein [Populus trichocarpa] gi|222847222|gb|EEE84769.1| predicted protein [Populus trichocarpa] Length = 421 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = +2 Query: 2 LRRGGRNERGLKEGLVLIYDCTTGEWSRGADLPDVIRRAACVCVMC 139 LRR GRN RGLKEGLVL+YDC +G WSRG LP+VIRRA CV V C Sbjct: 376 LRRSGRNVRGLKEGLVLVYDCVSGVWSRGPHLPEVIRRATCVTVEC 421 >ref|XP_004159361.1| PREDICTED: F-box/kelch-repeat protein At5g26960-like [Cucumis sativus] Length = 439 Score = 74.3 bits (181), Expect = 9e-12 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = +2 Query: 2 LRRGGRNERGLKEGLVLIYDCTTGEWSRGADLPDVIRRAACVCVMC 139 LRR GR+ RGLKEGLVLIY+ +GEW RGA++P+V++RAACVCV C Sbjct: 394 LRRSGRSARGLKEGLVLIYETKSGEWRRGAEMPEVMQRAACVCVEC 439