BLASTX nr result
ID: Cephaelis21_contig00037939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037939 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281211.1| PREDICTED: protein TIC 20-I, chloroplastic [... 66 3e-09 ref|XP_002307678.1| predicted protein [Populus trichocarpa] gi|1... 65 4e-09 ref|XP_002300750.1| predicted protein [Populus trichocarpa] gi|1... 65 4e-09 ref|XP_002510436.1| conserved hypothetical protein [Ricinus comm... 65 6e-09 ref|NP_171986.3| translocon at the inner envelope membrane of ch... 64 2e-08 >ref|XP_002281211.1| PREDICTED: protein TIC 20-I, chloroplastic [Vitis vinifera] gi|302142547|emb|CBI19750.3| unnamed protein product [Vitis vinifera] Length = 272 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 1 GMHFWTAVAVANLLTVLECLRCAVSGKYTEIPMISDAAYVQ 123 GMHFWTAVA L TVLEC+RCA++G Y +IP + DAAY+Q Sbjct: 228 GMHFWTAVAFGYLFTVLECIRCALAGMYADIPFVCDAAYIQ 268 >ref|XP_002307678.1| predicted protein [Populus trichocarpa] gi|118487446|gb|ABK95551.1| unknown [Populus trichocarpa] gi|222857127|gb|EEE94674.1| predicted protein [Populus trichocarpa] Length = 272 Score = 65.5 bits (158), Expect = 4e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 1 GMHFWTAVAVANLLTVLECLRCAVSGKYTEIPMISDAAYVQ 123 GMHFWTAVA A L TVLEC+RCA++G Y ++P DAAY+Q Sbjct: 228 GMHFWTAVAFAYLFTVLECIRCALAGMYADVPFACDAAYIQ 268 >ref|XP_002300750.1| predicted protein [Populus trichocarpa] gi|118482844|gb|ABK93337.1| unknown [Populus trichocarpa] gi|222842476|gb|EEE80023.1| predicted protein [Populus trichocarpa] Length = 272 Score = 65.5 bits (158), Expect = 4e-09 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 1 GMHFWTAVAVANLLTVLECLRCAVSGKYTEIPMISDAAYVQ 123 GMHFWTAVA A L TVLEC+RCA++G Y ++P DAAY+Q Sbjct: 228 GMHFWTAVAFAYLFTVLECIRCALAGMYADVPFACDAAYIQ 268 >ref|XP_002510436.1| conserved hypothetical protein [Ricinus communis] gi|223551137|gb|EEF52623.1| conserved hypothetical protein [Ricinus communis] Length = 276 Score = 65.1 bits (157), Expect = 6e-09 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +1 Query: 1 GMHFWTAVAVANLLTVLECLRCAVSGKYTEIPMISDAAYVQ 123 GMHFWTA+A A L TVLEC+RCA++G Y ++P DAAY+Q Sbjct: 232 GMHFWTAIAFAYLFTVLECIRCALAGMYADVPFACDAAYIQ 272 >ref|NP_171986.3| translocon at the inner envelope membrane of chloroplasts 20 [Arabidopsis thaliana] gi|75151589|sp|Q8GZ79.1|TI201_ARATH RecName: Full=Protein TIC 20-I, chloroplastic; AltName: Full=Translocon at the inner envelope membrane of chloroplasts 20-I; Short=AtTIC20-I; Flags: Precursor gi|26449432|dbj|BAC41843.1| unknown protein [Arabidopsis thaliana] gi|332189644|gb|AEE27765.1| translocon at the inner envelope membrane of chloroplasts 20 [Arabidopsis thaliana] Length = 274 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 1 GMHFWTAVAVANLLTVLECLRCAVSGKYTEIPMISDAAYVQ 123 GMHFWTAVA A L TVLE +RCA++G Y +IP + DAAY+Q Sbjct: 230 GMHFWTAVAFAYLFTVLESIRCALAGMYADIPFVCDAAYIQ 270