BLASTX nr result
ID: Cephaelis21_contig00037828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037828 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW68142.1| hypothetical protein ZEAMMB73_440075 [Zea mays] 55 4e-06 >gb|AFW68142.1| hypothetical protein ZEAMMB73_440075 [Zea mays] Length = 504 Score = 55.5 bits (132), Expect = 4e-06 Identities = 32/75 (42%), Positives = 43/75 (57%) Frame = +2 Query: 41 SGDFVCVKSIIDPTKTVAKGCIHSIGPNMKVGKHVL*SNWCQIHVKVILEAEEELIRPYD 220 +G V +KS PTKTVA G + PN KVG L + + V++++ E LIRPYD Sbjct: 425 TGAQVFLKSWRCPTKTVALGIVLGRDPNHKVGGVKLGREFWMVRVRLVILPIEPLIRPYD 484 Query: 221 HLEKIGDTLGELIPW 265 ++E IGD LI W Sbjct: 485 NMEVIGDVGNNLIAW 499