BLASTX nr result
ID: Cephaelis21_contig00037729
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037729 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16742.3| unnamed protein product [Vitis vinifera] 112 4e-23 ref|XP_003534752.1| PREDICTED: pentatricopeptide repeat-containi... 108 6e-22 ref|XP_002520828.1| pentatricopeptide repeat-containing protein,... 105 5e-21 ref|XP_004160443.1| PREDICTED: pentatricopeptide repeat-containi... 84 1e-14 ref|XP_004137551.1| PREDICTED: pentatricopeptide repeat-containi... 84 1e-14 >emb|CBI16742.3| unnamed protein product [Vitis vinifera] Length = 674 Score = 112 bits (279), Expect = 4e-23 Identities = 47/76 (61%), Positives = 64/76 (84%) Frame = +2 Query: 2 SSGSYVLLSNLYAANGRWDNFARVRKRMKESRVNKIPGYSQVEVKGENHVFYAGDRSHTE 181 SSG YVLL+N++AA G WD FA VRK+MK+ V K+PG+SQ+EVKG+ H F+AGD+SH + Sbjct: 583 SSGGYVLLANVFAARGNWDEFAEVRKKMKDRNVRKVPGFSQIEVKGKCHAFFAGDKSHPQ 642 Query: 182 IEQIYSLLKERLLPVM 229 +E+IY LL+E+LLP+M Sbjct: 643 VEEIYELLREKLLPIM 658 >ref|XP_003534752.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09410-like [Glycine max] Length = 669 Score = 108 bits (269), Expect = 6e-22 Identities = 47/76 (61%), Positives = 62/76 (81%) Frame = +2 Query: 2 SSGSYVLLSNLYAANGRWDNFARVRKRMKESRVNKIPGYSQVEVKGENHVFYAGDRSHTE 181 SSG YVLL+N YAA G+WD FA+VRKRM+E V +IPGYSQ+++ G+NHVF G+RSH + Sbjct: 579 SSGGYVLLANTYAAEGQWDEFAKVRKRMRERNVKRIPGYSQIQITGKNHVFVVGERSHPQ 638 Query: 182 IEQIYSLLKERLLPVM 229 IE+IY LL++ L P+M Sbjct: 639 IEEIYRLLQQNLQPLM 654 >ref|XP_002520828.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539959|gb|EEF41537.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 656 Score = 105 bits (261), Expect = 5e-21 Identities = 48/76 (63%), Positives = 61/76 (80%) Frame = +2 Query: 2 SSGSYVLLSNLYAANGRWDNFARVRKRMKESRVNKIPGYSQVEVKGENHVFYAGDRSHTE 181 SSGSYVLL+N YAA G+W+ FA VRK MKE V K PG+SQ+EVKG++HVF+ DRSH + Sbjct: 565 SSGSYVLLANAYAACGKWNEFAEVRKEMKERNVKKEPGFSQIEVKGKSHVFFVRDRSHPQ 624 Query: 182 IEQIYSLLKERLLPVM 229 +E+IY L E+LLP+M Sbjct: 625 LEEIYLFLDEKLLPLM 640 >ref|XP_004160443.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cucumis sativus] Length = 776 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/70 (52%), Positives = 51/70 (72%) Frame = +2 Query: 2 SSGSYVLLSNLYAANGRWDNFARVRKRMKESRVNKIPGYSQVEVKGENHVFYAGDRSHTE 181 +SG YVLLSNLYAA+GRW +R +M++ V K+PGYS VE++ + H+F GD SH E Sbjct: 606 NSGMYVLLSNLYAASGRWREVREMRSKMRDKGVKKVPGYSWVEIQNKTHIFTVGDCSHPE 665 Query: 182 IEQIYSLLKE 211 E+IY+ L+E Sbjct: 666 AERIYAYLEE 675 >ref|XP_004137551.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cucumis sativus] Length = 776 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/70 (52%), Positives = 51/70 (72%) Frame = +2 Query: 2 SSGSYVLLSNLYAANGRWDNFARVRKRMKESRVNKIPGYSQVEVKGENHVFYAGDRSHTE 181 +SG YVLLSNLYAA+GRW +R +M++ V K+PGYS VE++ + H+F GD SH E Sbjct: 606 NSGMYVLLSNLYAASGRWREVREMRSKMRDKGVKKVPGYSWVEIQNKTHIFTVGDCSHPE 665 Query: 182 IEQIYSLLKE 211 E+IY+ L+E Sbjct: 666 AERIYAYLEE 675