BLASTX nr result
ID: Cephaelis21_contig00037718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037718 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512618.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002512618.1| conserved hypothetical protein [Ricinus communis] gi|223548579|gb|EEF50070.1| conserved hypothetical protein [Ricinus communis] Length = 642 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = +3 Query: 6 ELGPSGEINISDIQKSLQSLYDYNVILRDKLVATQSILHALTQKKSSPSPEEGQS 170 E P EI SDIQK+LQ +Y+YN+ILR+KL+AT+S+LH+L KSS S E Q+ Sbjct: 589 EFKPESEIENSDIQKNLQHMYNYNIILREKLLATRSLLHSLA-TKSSTSLSESQT 642