BLASTX nr result
ID: Cephaelis21_contig00037698
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037698 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 48 2e-06 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 47.8 bits (112), Expect(2) = 2e-06 Identities = 27/54 (50%), Positives = 35/54 (64%) Frame = +2 Query: 125 MAKLVDATDLIRLGLGMGNLPSENFQIQRNPGINKRGNPEPNPVF*KQKFRTLK 286 MA+LVDATDLI L LGM + F+ + + K GNPEPNP F KQ ++L+ Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLEL-KMGNPEPNPSFRKQINKSLE 53 Score = 28.9 bits (63), Expect(2) = 2e-06 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 283 KKGIGAETQWKLF 321 KK IGAETQWKLF Sbjct: 57 KKRIGAETQWKLF 69