BLASTX nr result
ID: Cephaelis21_contig00037640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037640 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 >ref|XP_002270788.1| PREDICTED: pentatricopeptide repeat-containing protein At2g30780 [Vitis vinifera] gi|296086664|emb|CBI32299.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -3 Query: 399 SKKTFWILYKAYTQWGEKNKLETVAGMMCKRGYEIPS 289 +KKTFWILYKAY+ W +++K+E V G+MCK GY IPS Sbjct: 453 TKKTFWILYKAYSMWDQRHKVEQVKGLMCKHGYGIPS 489