BLASTX nr result
ID: Cephaelis21_contig00037572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037572 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302442.1| predicted protein [Populus trichocarpa] gi|2... 117 1e-24 ref|XP_002284636.1| PREDICTED: putative dihydroflavonol-4-reduct... 110 1e-22 emb|CAN78410.1| hypothetical protein VITISV_023179 [Vitis vinifera] 110 1e-22 ref|XP_002510243.1| dihydroflavonal-4-reductase, putative [Ricin... 108 5e-22 ref|XP_002302441.1| predicted protein [Populus trichocarpa] gi|2... 106 2e-21 >ref|XP_002302442.1| predicted protein [Populus trichocarpa] gi|222844168|gb|EEE81715.1| predicted protein [Populus trichocarpa] Length = 337 Score = 117 bits (292), Expect = 1e-24 Identities = 58/76 (76%), Positives = 62/76 (81%) Frame = -3 Query: 230 KVLVTGASGYLGGRLCHALLNQGHHVKAFVRRTSDLSCLPPPTSDGAALELAYGDVTDYP 51 K LVTGASGYLGGRLCH LL QGH V+A VRRTSD+S LPPP+S G ELAYGD+TDY Sbjct: 2 KALVTGASGYLGGRLCHGLLKQGHSVRALVRRTSDISELPPPSS-GGVFELAYGDITDYQ 60 Query: 50 SLLDASSDCHVIFHAA 3 SLLDA S C VIFHAA Sbjct: 61 SLLDAFSGCQVIFHAA 76 >ref|XP_002284636.1| PREDICTED: putative dihydroflavonol-4-reductase [Vitis vinifera] gi|302142332|emb|CBI19535.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 110 bits (275), Expect = 1e-22 Identities = 55/77 (71%), Positives = 61/77 (79%), Gaps = 1/77 (1%) Frame = -3 Query: 230 KVLVTGASGYLGGRLCHALLNQGHHVKAFVRRTSDLSCLPP-PTSDGAALELAYGDVTDY 54 KVLVTGASGYLGGRLCHALL GH V+AFVRR+SDLSCLPP D ALELAYGDVT+Y Sbjct: 2 KVLVTGASGYLGGRLCHALLRHGHVVRAFVRRSSDLSCLPPVGGGDDGALELAYGDVTEY 61 Query: 53 PSLLDASSDCHVIFHAA 3 ++L A C V+FH A Sbjct: 62 RAVLAACDGCQVVFHVA 78 >emb|CAN78410.1| hypothetical protein VITISV_023179 [Vitis vinifera] Length = 339 Score = 110 bits (275), Expect = 1e-22 Identities = 55/77 (71%), Positives = 61/77 (79%), Gaps = 1/77 (1%) Frame = -3 Query: 230 KVLVTGASGYLGGRLCHALLNQGHHVKAFVRRTSDLSCLPP-PTSDGAALELAYGDVTDY 54 KVLVTGASGYLGGRLCHALL GH V+AFVRR+SDLSCLPP D ALELAYGDVT+Y Sbjct: 2 KVLVTGASGYLGGRLCHALLRHGHVVRAFVRRSSDLSCLPPVGGGDDGALELAYGDVTEY 61 Query: 53 PSLLDASSDCHVIFHAA 3 ++L A C V+FH A Sbjct: 62 RAVLAACDGCQVVFHVA 78 >ref|XP_002510243.1| dihydroflavonal-4-reductase, putative [Ricinus communis] gi|223550944|gb|EEF52430.1| dihydroflavonal-4-reductase, putative [Ricinus communis] Length = 334 Score = 108 bits (270), Expect = 5e-22 Identities = 55/76 (72%), Positives = 63/76 (82%) Frame = -3 Query: 230 KVLVTGASGYLGGRLCHALLNQGHHVKAFVRRTSDLSCLPPPTSDGAALELAYGDVTDYP 51 KV+VTGASGYLGGRLCHAL+ +GH ++A VRRTSDLS L PT+D +LELAYGD+TDY Sbjct: 2 KVVVTGASGYLGGRLCHALIEEGHSIRALVRRTSDLSAL--PTAD--SLELAYGDITDYR 57 Query: 50 SLLDASSDCHVIFHAA 3 SLL A S CHVIFH A Sbjct: 58 SLLAAFSGCHVIFHTA 73 >ref|XP_002302441.1| predicted protein [Populus trichocarpa] gi|222844167|gb|EEE81714.1| predicted protein [Populus trichocarpa] Length = 338 Score = 106 bits (265), Expect = 2e-21 Identities = 55/77 (71%), Positives = 60/77 (77%) Frame = -3 Query: 233 KKVLVTGASGYLGGRLCHALLNQGHHVKAFVRRTSDLSCLPPPTSDGAALELAYGDVTDY 54 KK++VTGASG++GG LCH LL QGH V+A VRRTSDLS LP P S G ELAYGDVTDY Sbjct: 2 KKIVVTGASGFVGGVLCHTLLKQGHSVRALVRRTSDLSGLPSP-STGENFELAYGDVTDY 60 Query: 53 PSLLDASSDCHVIFHAA 3 SLLDA C VIFHAA Sbjct: 61 RSLLDAIFGCDVIFHAA 77