BLASTX nr result
ID: Cephaelis21_contig00037408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037408 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270464.1| PREDICTED: exosome complex component rrp45-l... 123 2e-26 ref|XP_004170431.1| PREDICTED: exosome complex component RRP45-l... 119 3e-25 ref|XP_004139042.1| PREDICTED: exosome complex component RRP45-l... 119 3e-25 emb|CAN74356.1| hypothetical protein VITISV_000912 [Vitis vinifera] 115 4e-24 ref|XP_002531128.1| exosome complex exonuclease rrp45, putative ... 112 4e-23 >ref|XP_002270464.1| PREDICTED: exosome complex component rrp45-like [Vitis vinifera] Length = 467 Score = 123 bits (308), Expect = 2e-26 Identities = 58/69 (84%), Positives = 65/69 (94%) Frame = +1 Query: 232 MEQRLANTFRMTVNEKKFIETALRSDLRVDGRRPFDYRELTVKFGREDGSSEVQLGQTHV 411 MEQRLA+TFRMTVNEKKFIE AL SDLR+DGRRPFD+R +++KFGREDGSSEVQLGQTHV Sbjct: 1 MEQRLASTFRMTVNEKKFIEKALLSDLRIDGRRPFDFRRISIKFGREDGSSEVQLGQTHV 60 Query: 412 MGFVTSQLV 438 MGFVT QL+ Sbjct: 61 MGFVTGQLI 69 >ref|XP_004170431.1| PREDICTED: exosome complex component RRP45-like [Cucumis sativus] Length = 454 Score = 119 bits (298), Expect = 3e-25 Identities = 57/69 (82%), Positives = 64/69 (92%) Frame = +1 Query: 232 MEQRLANTFRMTVNEKKFIETALRSDLRVDGRRPFDYRELTVKFGREDGSSEVQLGQTHV 411 MEQRLANT+R++ NEKKFIETAL SDLRVDGR PFDYR LT+ FG++DGSSEVQLGQTHV Sbjct: 1 MEQRLANTWRLSANEKKFIETALLSDLRVDGRGPFDYRNLTINFGKDDGSSEVQLGQTHV 60 Query: 412 MGFVTSQLV 438 MGFVT+QLV Sbjct: 61 MGFVTAQLV 69 >ref|XP_004139042.1| PREDICTED: exosome complex component RRP45-like [Cucumis sativus] Length = 452 Score = 119 bits (298), Expect = 3e-25 Identities = 57/69 (82%), Positives = 64/69 (92%) Frame = +1 Query: 232 MEQRLANTFRMTVNEKKFIETALRSDLRVDGRRPFDYRELTVKFGREDGSSEVQLGQTHV 411 MEQRLANT+R++ NEKKFIETAL SDLRVDGR PFDYR LT+ FG++DGSSEVQLGQTHV Sbjct: 1 MEQRLANTWRLSANEKKFIETALLSDLRVDGRGPFDYRNLTINFGKDDGSSEVQLGQTHV 60 Query: 412 MGFVTSQLV 438 MGFVT+QLV Sbjct: 61 MGFVTAQLV 69 >emb|CAN74356.1| hypothetical protein VITISV_000912 [Vitis vinifera] Length = 476 Score = 115 bits (288), Expect = 4e-24 Identities = 58/78 (74%), Positives = 65/78 (83%), Gaps = 9/78 (11%) Frame = +1 Query: 232 MEQRLANTFRMTVNEKKFIETALRSDLRVDGRRPFDYRELTVKFGR---------EDGSS 384 MEQRLA+TFRMTVNEKKFIE AL SDLR+DGRRPFD+R +++KFGR EDGSS Sbjct: 1 MEQRLASTFRMTVNEKKFIEKALLSDLRIDGRRPFDFRRISIKFGRQVFIRTICAEDGSS 60 Query: 385 EVQLGQTHVMGFVTSQLV 438 EVQLGQTHVMGFVT QL+ Sbjct: 61 EVQLGQTHVMGFVTGQLI 78 >ref|XP_002531128.1| exosome complex exonuclease rrp45, putative [Ricinus communis] gi|223529292|gb|EEF31262.1| exosome complex exonuclease rrp45, putative [Ricinus communis] Length = 463 Score = 112 bits (279), Expect = 4e-23 Identities = 54/69 (78%), Positives = 64/69 (92%) Frame = +1 Query: 232 MEQRLANTFRMTVNEKKFIETALRSDLRVDGRRPFDYRELTVKFGREDGSSEVQLGQTHV 411 ME R+A+T+RM+VNEKKFIE+AL SDLR+DGR ++R+LT+KFGREDGSSEVQLGQTHV Sbjct: 1 MEGRVASTWRMSVNEKKFIESALDSDLRIDGRNSHEFRKLTIKFGREDGSSEVQLGQTHV 60 Query: 412 MGFVTSQLV 438 MGFVTSQLV Sbjct: 61 MGFVTSQLV 69