BLASTX nr result
ID: Cephaelis21_contig00037274
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037274 (483 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138370.1| PREDICTED: polypyrimidine tract-binding prot... 63 3e-08 ref|XP_004162168.1| PREDICTED: polypyrimidine tract-binding prot... 59 3e-07 ref|XP_004138369.1| PREDICTED: polypyrimidine tract-binding prot... 59 3e-07 ref|XP_002893943.1| predicted protein [Arabidopsis lyrata subsp.... 59 3e-07 ref|XP_002264689.2| PREDICTED: polypyrimidine tract-binding prot... 59 4e-07 >ref|XP_004138370.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like isoform 2 [Cucumis sativus] Length = 408 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +1 Query: 1 SRDFTNPSLPSEQKGRSSHPGYGDVGGNYPLQ 96 SRDFTNPSLPSE KGRSS PGYGD GG YPLQ Sbjct: 153 SRDFTNPSLPSEPKGRSSQPGYGDTGGMYPLQ 184 >ref|XP_004162168.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like [Cucumis sativus] Length = 432 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +1 Query: 1 SRDFTNPSLPSEQKGRSSHPGYGDVGGNYP 90 SRDFTNPSLPSE KGRSS PGYGD GG YP Sbjct: 189 SRDFTNPSLPSEPKGRSSQPGYGDTGGMYP 218 >ref|XP_004138369.1| PREDICTED: polypyrimidine tract-binding protein homolog 3-like isoform 1 [Cucumis sativus] Length = 434 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +1 Query: 1 SRDFTNPSLPSEQKGRSSHPGYGDVGGNYP 90 SRDFTNPSLPSE KGRSS PGYGD GG YP Sbjct: 191 SRDFTNPSLPSEPKGRSSQPGYGDTGGMYP 220 >ref|XP_002893943.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297339785|gb|EFH70202.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 432 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 SRDFTNPSLPSEQKGRSSHPGYGDVGGNYP 90 SRD+TNP+LP+EQKGRSSHPGYGDVG YP Sbjct: 189 SRDYTNPNLPAEQKGRSSHPGYGDVGVAYP 218 >ref|XP_002264689.2| PREDICTED: polypyrimidine tract-binding protein homolog 3 isoform 1 [Vitis vinifera] Length = 445 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = +1 Query: 1 SRDFTNPSLPSEQKGRSSHPGYGDVGGNYPLQ 96 SRDFTNPSLPSEQKGRSS GYGD GG Y LQ Sbjct: 191 SRDFTNPSLPSEQKGRSSQSGYGDAGGMYALQ 222