BLASTX nr result
ID: Cephaelis21_contig00037270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037270 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27126.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002277341.1| PREDICTED: alanyl-tRNA synthetase-like [Viti... 58 7e-07 >emb|CBI27126.3| unnamed protein product [Vitis vinifera] Length = 1026 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = +3 Query: 258 SGLFQVNGVQIFGSFVVHISLFSDKAGRFSSGDKVICKIYPDPVRIVA 401 SG FQV VQI+G F++HI F++ +GRFS GDKVICK+ D +++A Sbjct: 619 SGSFQVCNVQIYGGFILHIGSFTEASGRFSVGDKVICKVDYDRRKVIA 666 >ref|XP_002277341.1| PREDICTED: alanyl-tRNA synthetase-like [Vitis vinifera] Length = 1002 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/48 (54%), Positives = 36/48 (75%) Frame = +3 Query: 258 SGLFQVNGVQIFGSFVVHISLFSDKAGRFSSGDKVICKIYPDPVRIVA 401 SG FQV VQI+G F++HI F++ +GRFS GDKVICK+ D +++A Sbjct: 595 SGSFQVCNVQIYGGFILHIGSFTEASGRFSVGDKVICKVDYDRRKVIA 642