BLASTX nr result
ID: Cephaelis21_contig00037219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037219 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301940.1| predicted protein [Populus trichocarpa] gi|2... 88 6e-16 ref|XP_004145525.1| PREDICTED: U11/U12 small nuclear ribonucleop... 86 3e-15 gb|ADN34128.1| hypothetical protein [Cucumis melo subsp. melo] 86 3e-15 ref|XP_002285907.1| PREDICTED: U11/U12 small nuclear ribonucleop... 85 7e-15 ref|XP_003538972.1| PREDICTED: U11/U12 small nuclear ribonucleop... 80 1e-13 >ref|XP_002301940.1| predicted protein [Populus trichocarpa] gi|222843666|gb|EEE81213.1| predicted protein [Populus trichocarpa] Length = 173 Score = 88.2 bits (217), Expect = 6e-16 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +3 Query: 138 YTKSNVRKVKLRSTLAALLDNPILADVPKKPTLSDVDTLISLDLGSAMRISVLK 299 Y SNV+K KL+STLAALLD+PIL+DVPKKPTLSDVDTLISL++GSAMRISV K Sbjct: 14 YNSSNVKKAKLQSTLAALLDDPILSDVPKKPTLSDVDTLISLEMGSAMRISVQK 67 >ref|XP_004145525.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like [Cucumis sativus] Length = 181 Score = 85.9 bits (211), Expect = 3e-15 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +3 Query: 138 YTKSNVRKVKLRSTLAALLDNPILADVPKKPTLSDVDTLISLDLGSAMRISVLK 299 Y +NV+KV+L STLAALLD+PILADVPK PTLS VDTLISL+LGSAMRISVLK Sbjct: 22 YHSNNVKKVRLNSTLAALLDDPILADVPKNPTLSHVDTLISLELGSAMRISVLK 75 >gb|ADN34128.1| hypothetical protein [Cucumis melo subsp. melo] Length = 181 Score = 85.9 bits (211), Expect = 3e-15 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +3 Query: 138 YTKSNVRKVKLRSTLAALLDNPILADVPKKPTLSDVDTLISLDLGSAMRISVLK 299 Y +NV+KV+L STLAALLD+PILADVPK PTLS VDTLISL+LGSAMRISVLK Sbjct: 22 YHSNNVKKVRLNSTLAALLDDPILADVPKNPTLSHVDTLISLELGSAMRISVLK 75 >ref|XP_002285907.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein [Vitis vinifera] gi|302141700|emb|CBI18903.3| unnamed protein product [Vitis vinifera] Length = 176 Score = 84.7 bits (208), Expect = 7e-15 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = +3 Query: 138 YTKSNVRKVKLRSTLAALLDNPILADVPKKPTLSDVDTLISLDLGSAMRISVLK 299 Y +NV+K +L STL ALLD+PILADVPK+PTLSDVDTLI+L+LGSAMRISV+K Sbjct: 17 YNSNNVKKARLHSTLTALLDDPILADVPKEPTLSDVDTLINLELGSAMRISVIK 70 >ref|XP_003538972.1| PREDICTED: U11/U12 small nuclear ribonucleoprotein 25 kDa protein-like [Glycine max] Length = 187 Score = 80.5 bits (197), Expect = 1e-13 Identities = 39/55 (70%), Positives = 47/55 (85%) Frame = +3 Query: 135 EYTKSNVRKVKLRSTLAALLDNPILADVPKKPTLSDVDTLISLDLGSAMRISVLK 299 EY KS+V+K +L S L LLD+PIL+DVPK PT +DVDTLI+L+LGSAMRISVLK Sbjct: 27 EYNKSSVKKARLNSLLTTLLDDPILSDVPKNPTFADVDTLINLELGSAMRISVLK 81