BLASTX nr result
ID: Cephaelis21_contig00037007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00037007 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002881563.1| proton-dependent oligopeptide transport fami... 57 1e-06 ref|NP_181345.1| proton-dependent oligopeptide transport-like pr... 57 2e-06 >ref|XP_002881563.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] gi|297327402|gb|EFH57822.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] Length = 521 Score = 57.4 bits (137), Expect = 1e-06 Identities = 32/87 (36%), Positives = 48/87 (55%) Frame = -3 Query: 263 AAGIMNVANGLPKVLPLVFYYFVDAGLGNYWMLLISSFSFVIGLGLLSMSTPPVLAEVTG 84 AA I+NV G+ + L + VDA +G++WML +S+ +F G G L++S P+L+ Sbjct: 33 AAAIVNVFAGVSAIGHLSMQFLVDAFIGHFWMLCLSTLAFSFGFGFLAISASPILS---- 88 Query: 83 TCKDYEPDCIGQIQKALFYTALALIAV 3 G QK LFY AL +I+V Sbjct: 89 ----------GNGQKGLFYVALTVISV 105 >ref|NP_181345.1| proton-dependent oligopeptide transport-like protein [Arabidopsis thaliana] gi|75223187|sp|O80436.1|PTR29_ARATH RecName: Full=Putative peptide/nitrate transporter At2g38100 gi|3335358|gb|AAC27159.1| putative peptide/amino acid transporter [Arabidopsis thaliana] gi|330254395|gb|AEC09489.1| proton-dependent oligopeptide transport-like protein [Arabidopsis thaliana] Length = 521 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/87 (36%), Positives = 48/87 (55%) Frame = -3 Query: 263 AAGIMNVANGLPKVLPLVFYYFVDAGLGNYWMLLISSFSFVIGLGLLSMSTPPVLAEVTG 84 AA I+NV G+ + L + VDA +G++WML +S+ +F G G L++S P+L+ Sbjct: 33 AAAIVNVFAGVSAIGHLGMQFLVDAFIGHFWMLCLSTLAFSFGFGFLAISASPILS---- 88 Query: 83 TCKDYEPDCIGQIQKALFYTALALIAV 3 G QK LFY AL +I+V Sbjct: 89 ----------GNGQKGLFYVALTVISV 105