BLASTX nr result
ID: Cephaelis21_contig00036972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00036972 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514322.1| conserved hypothetical protein [Ricinus comm... 65 8e-09 ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|2... 65 8e-09 ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago ... 55 5e-06 >ref|XP_002514322.1| conserved hypothetical protein [Ricinus communis] gi|223546778|gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 64.7 bits (156), Expect = 8e-09 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +2 Query: 200 AASTGEVMKKCVCSPTRHPGSFRCRHHHADYQWVGRLSPK 319 A G +K CVCSPTRHPGSFRCRHHH DY W R++ K Sbjct: 51 AGGGGGSIKMCVCSPTRHPGSFRCRHHHVDYAWGRRITKK 90 >ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|222865848|gb|EEF02979.1| predicted protein [Populus trichocarpa] Length = 85 Score = 64.7 bits (156), Expect = 8e-09 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +2 Query: 197 GAASTGEVMKKCVCSPTRHPGSFRCRHHHADYQWVGRLS 313 G+++ +KKC+CSPTRHPGSFRCRHH +DY W GR++ Sbjct: 41 GSSAVAGSIKKCLCSPTRHPGSFRCRHHRSDYVWGGRIT 79 >ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|222873229|gb|EEF10360.1| predicted protein [Populus trichocarpa] Length = 88 Score = 64.3 bits (155), Expect = 1e-08 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = +2 Query: 197 GAASTGEVMKKCVCSPTRHPGSFRCRHHHADYQWVGRLSPK 319 G ++ + KC+CSPTRHPGSFRCRHH +DY W GR++ K Sbjct: 41 GGSAISRSINKCLCSPTRHPGSFRCRHHRSDYVWSGRITRK 81 >ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|357521031|ref|XP_003630804.1| hypothetical protein MTR_8g103600 [Medicago truncatula] gi|355523664|gb|AET04118.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|355524826|gb|AET05280.1| hypothetical protein MTR_8g103600 [Medicago truncatula] Length = 83 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/58 (43%), Positives = 34/58 (58%) Frame = +2 Query: 134 VETVVRQNQPISGMVRSRYGEGAASTGEVMKKCVCSPTRHPGSFRCRHHHADYQWVGR 307 V+TV + + ++R G A +K+CVCSP++HPGSFRCR H A Y W R Sbjct: 23 VDTVAGEEPVVVVAGQARGGGDRAGEDGSIKQCVCSPSKHPGSFRCRQHQAKYVWRNR 80