BLASTX nr result
ID: Cephaelis21_contig00036901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00036901 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301657.1| predicted protein [Populus trichocarpa] gi|2... 95 7e-18 ref|XP_003530188.1| PREDICTED: pentatricopeptide repeat-containi... 93 3e-17 ref|NP_188050.1| pentatricopeptide repeat-containing protein [Ar... 91 7e-17 ref|XP_002885037.1| pentatricopeptide repeat-containing protein ... 91 7e-17 dbj|BAB01039.1| unnamed protein product [Arabidopsis thaliana] 91 7e-17 >ref|XP_002301657.1| predicted protein [Populus trichocarpa] gi|222843383|gb|EEE80930.1| predicted protein [Populus trichocarpa] Length = 504 Score = 94.7 bits (234), Expect = 7e-18 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +1 Query: 1 QITKNLRVCADCHSWMKLVSEVTSRKIILRDTNRFHHFNKGTCSCNDYW 147 +ITKNLRVC DCHSW+K+VS VT R I+LRDTNRFHHF +G CSCNDYW Sbjct: 456 RITKNLRVCVDCHSWIKIVSRVTGRVIVLRDTNRFHHFKEGACSCNDYW 504 >ref|XP_003530188.1| PREDICTED: pentatricopeptide repeat-containing protein At3g14330-like [Glycine max] Length = 650 Score = 92.8 bits (229), Expect = 3e-17 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = +1 Query: 1 QITKNLRVCADCHSWMKLVSEVTSRKIILRDTNRFHHFNKGTCSCNDYW 147 +ITKNLRVC DCHSWMK VS+VT R I+LRDTNRFHHF G+CSC DYW Sbjct: 602 RITKNLRVCVDCHSWMKAVSKVTRRLIVLRDTNRFHHFENGSCSCKDYW 650 >ref|NP_188050.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546762|sp|Q9LUL5.2|PP229_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g14330 gi|332641981|gb|AEE75502.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 710 Score = 91.3 bits (225), Expect = 7e-17 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = +1 Query: 1 QITKNLRVCADCHSWMKLVSEVTSRKIILRDTNRFHHFNKGTCSCNDYW 147 +ITKNLRVCADCHSWMK+VS+VT R I+LRDT RFHHF G CSC DYW Sbjct: 662 RITKNLRVCADCHSWMKIVSQVTRRVIVLRDTKRFHHFVDGICSCKDYW 710 >ref|XP_002885037.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330877|gb|EFH61296.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 690 Score = 91.3 bits (225), Expect = 7e-17 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +1 Query: 1 QITKNLRVCADCHSWMKLVSEVTSRKIILRDTNRFHHFNKGTCSCNDYW 147 ++TKNLRVCADCHSWMK+VS+VT R I+LRDT RFHHF G CSC DYW Sbjct: 642 RVTKNLRVCADCHSWMKIVSQVTGRVIVLRDTKRFHHFVAGICSCKDYW 690 >dbj|BAB01039.1| unnamed protein product [Arabidopsis thaliana] Length = 717 Score = 91.3 bits (225), Expect = 7e-17 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = +1 Query: 1 QITKNLRVCADCHSWMKLVSEVTSRKIILRDTNRFHHFNKGTCSCNDYW 147 +ITKNLRVCADCHSWMK+VS+VT R I+LRDT RFHHF G CSC DYW Sbjct: 669 RITKNLRVCADCHSWMKIVSQVTRRVIVLRDTKRFHHFVDGICSCKDYW 717