BLASTX nr result
ID: Cephaelis21_contig00036882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00036882 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA77239.1| endo-1,4-beta glucanase [Populus alba] gi|133833... 87 2e-15 gb|AFZ78635.1| korrigan [Populus tomentosa] 86 4e-15 ref|XP_003601448.1| Endo-1 4-beta-glucanase [Medicago truncatula... 86 4e-15 ref|XP_002299423.1| predicted protein [Populus trichocarpa] gi|2... 86 4e-15 gb|AAB65155.1| acidic cellulase [Citrus sinensis] 85 5e-15 >dbj|BAA77239.1| endo-1,4-beta glucanase [Populus alba] gi|13383305|dbj|BAB39483.1| endo-1,4-beta-glucanase [Populus alba] Length = 494 Score = 86.7 bits (213), Expect = 2e-15 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = +3 Query: 69 AFTSQQYSDAFRKSILFFEGQRSGKLPPNQHLTWRGDSGLSDGSGYH 209 AFTSQ Y+DA KSILFFEGQRSGKLP NQ LTWRGDSGLSDGS YH Sbjct: 27 AFTSQDYADALEKSILFFEGQRSGKLPVNQRLTWRGDSGLSDGSAYH 73 >gb|AFZ78635.1| korrigan [Populus tomentosa] Length = 494 Score = 85.5 bits (210), Expect = 4e-15 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = +3 Query: 66 YAFTSQQYSDAFRKSILFFEGQRSGKLPPNQHLTWRGDSGLSDGSGYH 209 +AFTSQ Y++A KSILFFEGQRSGKLP NQ LTWRGDSGLSDGS YH Sbjct: 26 FAFTSQDYANALEKSILFFEGQRSGKLPSNQRLTWRGDSGLSDGSTYH 73 >ref|XP_003601448.1| Endo-1 4-beta-glucanase [Medicago truncatula] gi|357517079|ref|XP_003628828.1| Endo-1 4-beta-glucanase [Medicago truncatula] gi|355490496|gb|AES71699.1| Endo-1 4-beta-glucanase [Medicago truncatula] gi|355522850|gb|AET03304.1| Endo-1 4-beta-glucanase [Medicago truncatula] Length = 499 Score = 85.5 bits (210), Expect = 4e-15 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = +3 Query: 66 YAFTSQQYSDAFRKSILFFEGQRSGKLPPNQHLTWRGDSGLSDGSGYH 209 +AFTSQ Y +A KSILFFEGQRSGKLP NQ LTWRGDSGLSDGS YH Sbjct: 29 FAFTSQDYHEALEKSILFFEGQRSGKLPSNQKLTWRGDSGLSDGSSYH 76 >ref|XP_002299423.1| predicted protein [Populus trichocarpa] gi|222846681|gb|EEE84228.1| predicted protein [Populus trichocarpa] gi|347466577|gb|AEO97201.1| endo-1,4-beta-glucanase [Populus trichocarpa] gi|347466631|gb|AEO97228.1| endo-1,4-beta-glucanase [Populus trichocarpa] Length = 494 Score = 85.5 bits (210), Expect = 4e-15 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = +3 Query: 66 YAFTSQQYSDAFRKSILFFEGQRSGKLPPNQHLTWRGDSGLSDGSGYH 209 +AFTSQ Y++A KSILFFEGQRSGKLP NQ LTWRGDSGLSDGS YH Sbjct: 26 FAFTSQDYANALEKSILFFEGQRSGKLPSNQRLTWRGDSGLSDGSTYH 73 >gb|AAB65155.1| acidic cellulase [Citrus sinensis] Length = 505 Score = 85.1 bits (209), Expect = 5e-15 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = +3 Query: 69 AFTSQQYSDAFRKSILFFEGQRSGKLPPNQHLTWRGDSGLSDGSGYH 209 AFT Q YSDA KSILFFEGQRSG+LPPNQ LTWRG+SGLSDGS YH Sbjct: 35 AFTFQDYSDALGKSILFFEGQRSGRLPPNQQLTWRGNSGLSDGSSYH 81