BLASTX nr result
ID: Cephaelis21_contig00036705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00036705 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603472.1| PsbP domain-containing protein [Medicago tru... 108 5e-22 tpg|DAA58570.1| TPA: hypothetical protein ZEAMMB73_217387 [Zea m... 105 5e-21 ref|XP_002309586.1| predicted protein [Populus trichocarpa] gi|2... 104 7e-21 gb|AFW83282.1| hypothetical protein ZEAMMB73_148957 [Zea mays] 103 2e-20 gb|AFW83279.1| hypothetical protein ZEAMMB73_148957 [Zea mays] 103 2e-20 >ref|XP_003603472.1| PsbP domain-containing protein [Medicago truncatula] gi|355492520|gb|AES73723.1| PsbP domain-containing protein [Medicago truncatula] Length = 293 Score = 108 bits (270), Expect = 5e-22 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = -3 Query: 296 STAERDGYLYSLSASTLSKKWNRMGPLLQKTVASFRLVTPTENYVPPYKDPWRFW 132 STAERDGYLYS+SASTLS +W +MGPLL+KTV+SFRLV+PTENYVPPYKDPWRFW Sbjct: 239 STAERDGYLYSISASTLSPQWKKMGPLLEKTVSSFRLVSPTENYVPPYKDPWRFW 293 >tpg|DAA58570.1| TPA: hypothetical protein ZEAMMB73_217387 [Zea mays] Length = 100 Score = 105 bits (261), Expect = 5e-21 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -3 Query: 293 TAERDGYLYSLSASTLSKKWNRMGPLLQKTVASFRLVTPTENYVPPYKDPWRFW 132 TAERDGYLYSL+ASTLSK+W MGP LQ+TVASFRL+ PTENYVPPYKDPWRFW Sbjct: 47 TAERDGYLYSLNASTLSKQWESMGPFLQQTVASFRLLPPTENYVPPYKDPWRFW 100 >ref|XP_002309586.1| predicted protein [Populus trichocarpa] gi|222855562|gb|EEE93109.1| predicted protein [Populus trichocarpa] Length = 295 Score = 104 bits (260), Expect = 7e-21 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = -3 Query: 296 STAERDGYLYSLSASTLSKKWNRMGPLLQKTVASFRLVTPTENYVPPYKDPWRFW 132 STAERDGYLYSLSASTLSK+W++MGP L+KTVASFRL+ PT +YVPPYKDPWRFW Sbjct: 241 STAERDGYLYSLSASTLSKQWDKMGPYLEKTVASFRLLPPTGDYVPPYKDPWRFW 295 >gb|AFW83282.1| hypothetical protein ZEAMMB73_148957 [Zea mays] Length = 258 Score = 103 bits (256), Expect = 2e-20 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -3 Query: 293 TAERDGYLYSLSASTLSKKWNRMGPLLQKTVASFRLVTPTENYVPPYKDPWRFW 132 TAERDGYLYSL+ASTLSK+W MGP LQKTVASFRL+ TENYVPPYKDPWRFW Sbjct: 205 TAERDGYLYSLNASTLSKQWESMGPFLQKTVASFRLLPGTENYVPPYKDPWRFW 258 >gb|AFW83279.1| hypothetical protein ZEAMMB73_148957 [Zea mays] Length = 252 Score = 103 bits (256), Expect = 2e-20 Identities = 46/54 (85%), Positives = 49/54 (90%) Frame = -3 Query: 293 TAERDGYLYSLSASTLSKKWNRMGPLLQKTVASFRLVTPTENYVPPYKDPWRFW 132 TAERDGYLYSL+ASTLSK+W MGP LQKTVASFRL+ TENYVPPYKDPWRFW Sbjct: 199 TAERDGYLYSLNASTLSKQWESMGPFLQKTVASFRLLPGTENYVPPYKDPWRFW 252