BLASTX nr result
ID: Cephaelis21_contig00035950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00035950 (335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK42885.1| unknown [Lotus japonicus] 79 3e-13 ref|XP_002534772.1| ATP synthase 9 mitochondrial, putative [Rici... 79 5e-13 gb|AAW30248.1| ATP synthase F0 subunit 9 [Aloe vera] 78 6e-13 gb|AAW30242.1| ATP synthase F0 subunit 9 [Piper betle] 78 6e-13 ref|NP_943666.1| ATP synthase F0 subunit 9 [Chara vulgaris] gi|3... 78 6e-13 >gb|AFK42885.1| unknown [Lotus japonicus] Length = 90 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/57 (63%), Positives = 43/57 (75%) Frame = +1 Query: 1 GSCCRYWKRF*FLDSFCGAKSIIG*TIIWLCHFGLCSNRSYCIVCPNDGLFDLIRIL 171 GSCCRYWKR F++SF G KSIIG +I +C+ GLCSNR YC+V NDGLFD + L Sbjct: 30 GSCCRYWKRIQFINSFRGKKSIIGKAVIRICNPGLCSNRGYCLVRINDGLFDSLCFL 86 >ref|XP_002534772.1| ATP synthase 9 mitochondrial, putative [Ricinus communis] gi|223524593|gb|EEF27607.1| ATP synthase 9 mitochondrial, putative [Ricinus communis] Length = 101 Score = 78.6 bits (192), Expect = 5e-13 Identities = 43/61 (70%), Positives = 43/61 (70%) Frame = +2 Query: 2 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXXXSKK 181 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTE SKK Sbjct: 19 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIASFALMMAFLILFVFRSKK 78 Query: 182 E 184 E Sbjct: 79 E 79 >gb|AAW30248.1| ATP synthase F0 subunit 9 [Aloe vera] Length = 59 Score = 78.2 bits (191), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +2 Query: 2 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTE 118 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 11 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|AAW30242.1| ATP synthase F0 subunit 9 [Piper betle] Length = 59 Score = 78.2 bits (191), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +2 Query: 2 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTE 118 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 11 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >ref|NP_943666.1| ATP synthase F0 subunit 9 [Chara vulgaris] gi|385153404|ref|YP_006073002.1| atp9 gene product (mitochondrion) [Nitella hyalina] gi|32966588|gb|AAP92171.1| ATP synthase F0 subunit 9 [Chara vulgaris] gi|335354135|gb|AEH42822.1| ATP synthase F0 subunit 9 (mitochondrion) [Nitella hyalina] Length = 76 Score = 78.2 bits (191), Expect = 6e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = +2 Query: 2 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTE 118 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 21 GAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTE 59