BLASTX nr result
ID: Cephaelis21_contig00035881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00035881 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328983.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_003610849.1| Protein SMG9 [Medicago truncatula] gi|355512... 57 2e-06 ref|XP_003516730.1| PREDICTED: protein SMG9-like [Glycine max] 55 6e-06 ref|XP_002274201.1| PREDICTED: protein SMG9 [Vitis vinifera] gi|... 55 8e-06 >ref|XP_002328983.1| predicted protein [Populus trichocarpa] gi|222839217|gb|EEE77568.1| predicted protein [Populus trichocarpa] Length = 408 Score = 58.5 bits (140), Expect = 5e-07 Identities = 35/64 (54%), Positives = 36/64 (56%), Gaps = 5/64 (7%) Frame = -1 Query: 177 APKILLAKPPALVTR-----PVXXXXXXXXXXXXXXATRSRLPSIGSLNLLSDSWDFSPD 13 APKILLAKPP LVT RSRLPSI SLNLLSDSWDF D Sbjct: 11 APKILLAKPPGLVTSGPAVSAAAAKFGREDETAPHHHHRSRLPSITSLNLLSDSWDFHID 70 Query: 12 KFLP 1 +FLP Sbjct: 71 RFLP 74 >ref|XP_003610849.1| Protein SMG9 [Medicago truncatula] gi|355512184|gb|AES93807.1| Protein SMG9 [Medicago truncatula] Length = 396 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/63 (49%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = -1 Query: 186 PQTAPKILLAKPPALVTRPVXXXXXXXXXXXXXXAT-RSRLPSIGSLNLLSDSWDFSPDK 10 P +PKILLAKP + P+ RSRLPS+ SLNLLSDSWDF D+ Sbjct: 6 PSPSPKILLAKPGLVTGAPISGKFNRSGAGEDDSTQHRSRLPSVASLNLLSDSWDFHFDR 65 Query: 9 FLP 1 FLP Sbjct: 66 FLP 68 >ref|XP_003516730.1| PREDICTED: protein SMG9-like [Glycine max] Length = 392 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/62 (50%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = -1 Query: 183 QTAPKILLAKPPALVTRPVXXXXXXXXXXXXXXAT-RSRLPSIGSLNLLSDSWDFSPDKF 7 + +PKILLAKP + PV RSRLPS+ SLNLLSDSWDF D+F Sbjct: 5 EPSPKILLAKPGLVTGGPVAGKFGRGGGGDDDSPQLRSRLPSVASLNLLSDSWDFHIDRF 64 Query: 6 LP 1 LP Sbjct: 65 LP 66 >ref|XP_002274201.1| PREDICTED: protein SMG9 [Vitis vinifera] gi|297737327|emb|CBI26528.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 54.7 bits (130), Expect = 8e-06 Identities = 33/70 (47%), Positives = 36/70 (51%), Gaps = 8/70 (11%) Frame = -1 Query: 186 PQTAPKILLAKPPALVTRPVXXXXXXXXXXXXXXA--------TRSRLPSIGSLNLLSDS 31 P APKILLAKP + T V RSRLP IGSLNLLSDS Sbjct: 15 PAPAPKILLAKPGLVTTGSVSSKLIRSGAAGGGGGGAEDESVSLRSRLPPIGSLNLLSDS 74 Query: 30 WDFSPDKFLP 1 W+F D+FLP Sbjct: 75 WEFHTDRFLP 84