BLASTX nr result
ID: Cephaelis21_contig00035840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00035840 (585 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322815.1| predicted protein [Populus trichocarpa] gi|2... 69 8e-10 >ref|XP_002322815.1| predicted protein [Populus trichocarpa] gi|222867445|gb|EEF04576.1| predicted protein [Populus trichocarpa] Length = 63 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/49 (71%), Positives = 37/49 (75%) Frame = -1 Query: 324 RLVSQNIRSGRLRAFAFAGLESLCCFTLPWMSEAPFCIFLNLLFFFMDF 178 +LVSQNIRSGRLRAFAFAGLESLCCF LPWMSE LN F +F Sbjct: 18 KLVSQNIRSGRLRAFAFAGLESLCCFILPWMSETS---ILNEFFGLSEF 63