BLASTX nr result
ID: Cephaelis21_contig00035738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00035738 (352 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135802.1| PREDICTED: probable RNA-dependent RNA polyme... 57 2e-06 ref|NP_179583.3| RNA-dependent RNA polymerase-like protein [Arab... 56 3e-06 ref|XP_002883963.1| RNA-dependent RNA polymerase family protein ... 56 3e-06 ref|XP_002455002.1| hypothetical protein SORBIDRAFT_03g002800 [S... 56 3e-06 ref|XP_002514231.1| RNA-dependent RNA polymerase, putative [Rici... 56 3e-06 >ref|XP_004135802.1| PREDICTED: probable RNA-dependent RNA polymerase 5-like [Cucumis sativus] Length = 1056 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/51 (58%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = -1 Query: 151 YFLFLLMVPFLHFPPGKL-VYRDNGQISGKVLVYRNPGLHFGDIHVLEAVY 2 Y+L + P G++ V NGQI+GKVLVYRNPGLHFGDIHVL A Y Sbjct: 678 YYLMGTVDPTFTLESGEVCVILYNGQINGKVLVYRNPGLHFGDIHVLTAKY 728 >ref|NP_179583.3| RNA-dependent RNA polymerase-like protein [Arabidopsis thaliana] gi|322967572|sp|O82188.2|RDR5_ARATH RecName: Full=Probable RNA-dependent RNA polymerase 5; Short=AtRDRP5; AltName: Full=RNA-directed RNA polymerase 5 gi|330251850|gb|AEC06944.1| RNA-dependent RNA polymerase-like protein [Arabidopsis thaliana] Length = 977 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 97 VYRDNGQISGKVLVYRNPGLHFGDIHVLEAVY 2 V ++GQISG+VLVYRNPGLHFGDIH+L+A Y Sbjct: 618 VILESGQISGEVLVYRNPGLHFGDIHILKATY 649 >ref|XP_002883963.1| RNA-dependent RNA polymerase family protein [Arabidopsis lyrata subsp. lyrata] gi|297329803|gb|EFH60222.1| RNA-dependent RNA polymerase family protein [Arabidopsis lyrata subsp. lyrata] Length = 981 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 97 VYRDNGQISGKVLVYRNPGLHFGDIHVLEAVY 2 V ++GQISG+VLVYRNPGLHFGDIH+L+A Y Sbjct: 622 VILESGQISGEVLVYRNPGLHFGDIHILKATY 653 >ref|XP_002455002.1| hypothetical protein SORBIDRAFT_03g002800 [Sorghum bicolor] gi|241926977|gb|EES00122.1| hypothetical protein SORBIDRAFT_03g002800 [Sorghum bicolor] Length = 1127 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -1 Query: 88 DNGQISGKVLVYRNPGLHFGDIHVLEAVY 2 DNGQ+SGKVLVY++PGLHFGDIH+L A Y Sbjct: 763 DNGQLSGKVLVYKHPGLHFGDIHILTATY 791 >ref|XP_002514231.1| RNA-dependent RNA polymerase, putative [Ricinus communis] gi|223546687|gb|EEF48185.1| RNA-dependent RNA polymerase, putative [Ricinus communis] Length = 114 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 88 DNGQISGKVLVYRNPGLHFGDIHVLEAVY 2 DN ISGKVLVYRNPGLHFGDIHVL+A Y Sbjct: 24 DNEHISGKVLVYRNPGLHFGDIHVLKATY 52