BLASTX nr result
ID: Cephaelis21_contig00035718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00035718 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulga... 55 8e-06 >emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 744 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/78 (32%), Positives = 43/78 (55%) Frame = +1 Query: 16 VPAWIEFEKLPIFLFQKDVLFALASTVGIPLRLDVNTAALCKPSVARIQVELNLLKDRPD 195 + WI F +LP+ + K+ LFA+A VG P+++D T + + AR+ +EL+L K Sbjct: 209 IMVWIRFPELPLEYYDKEALFAIAGKVGKPIKVDYATDHMARGRYARVCIELDLAKALVS 268 Query: 196 CIWIGLGEEEEFWQKIKY 249 +W+ WQ ++Y Sbjct: 269 KVWVA-----RAWQNVEY 281