BLASTX nr result
ID: Cephaelis21_contig00035689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00035689 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21372.3| unnamed protein product [Vitis vinifera] 59 4e-07 ref|XP_002278393.1| PREDICTED: UPF0481 protein At3g47200-like [V... 59 4e-07 emb|CAN59797.1| hypothetical protein VITISV_038869 [Vitis vinifera] 59 4e-07 gb|AFK38916.1| unknown [Medicago truncatula] 56 4e-06 ref|XP_003611672.1| hypothetical protein MTR_5g016570 [Medicago ... 56 4e-06 >emb|CBI21372.3| unnamed protein product [Vitis vinifera] Length = 466 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 160 MVAVFNKELLSWYLITLKLNETIEAGVSKVHDPTTASRSI 41 MVAVFNKELLSWYLITLKL ET+EAG+ + T++RSI Sbjct: 1 MVAVFNKELLSWYLITLKLKETVEAGIPNLPGTPTSARSI 40 >ref|XP_002278393.1| PREDICTED: UPF0481 protein At3g47200-like [Vitis vinifera] Length = 527 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 160 MVAVFNKELLSWYLITLKLNETIEAGVSKVHDPTTASRSI 41 MVAVFNKELLSWYLITLKL ET+EAG+ + T++RSI Sbjct: 1 MVAVFNKELLSWYLITLKLKETVEAGIPNLPGTPTSARSI 40 >emb|CAN59797.1| hypothetical protein VITISV_038869 [Vitis vinifera] Length = 752 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 160 MVAVFNKELLSWYLITLKLNETIEAGVSKVHDPTTASRSI 41 MVAVFNKELLSWYLITLKL ET+EAG+ + T++RSI Sbjct: 1 MVAVFNKELLSWYLITLKLKETVEAGIPNLPGTPTSARSI 40 >gb|AFK38916.1| unknown [Medicago truncatula] Length = 534 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 160 MVAVFNKELLSWYLITLKLNETIEAGVSKVHDPTTASRSI 41 MVAVFNKELLSWYLITLKL ET+EAG+ P + +RSI Sbjct: 1 MVAVFNKELLSWYLITLKLRETLEAGIPS-SSPNSGTRSI 39 >ref|XP_003611672.1| hypothetical protein MTR_5g016570 [Medicago truncatula] gi|355513007|gb|AES94630.1| hypothetical protein MTR_5g016570 [Medicago truncatula] Length = 534 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 160 MVAVFNKELLSWYLITLKLNETIEAGVSKVHDPTTASRSI 41 MVAVFNKELLSWYLITLKL ET+EAG+ P + +RSI Sbjct: 1 MVAVFNKELLSWYLITLKLRETLEAGIPS-SSPNSGTRSI 39