BLASTX nr result
ID: Cephaelis21_contig00034368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00034368 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524214.1| tropinone reductase, putative [Ricinus commu... 64 2e-08 gb|AFK36242.1| unknown [Medicago truncatula] 63 3e-08 ref|ZP_10205577.1| tropinone reductase [Rhodanobacter thiooxydan... 63 3e-08 emb|CBI16078.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_002282638.1| PREDICTED: tropinone reductase homolog At1g0... 63 3e-08 >ref|XP_002524214.1| tropinone reductase, putative [Ricinus communis] gi|223536491|gb|EEF38138.1| tropinone reductase, putative [Ricinus communis] Length = 272 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -3 Query: 275 PEEVSSLVAFLCLPAASYITGQIIAVDGGMMAYGF 171 P EVSSLVAFLCLPAASYITGQII+VDGGM A GF Sbjct: 230 PTEVSSLVAFLCLPAASYITGQIISVDGGMTANGF 264 >gb|AFK36242.1| unknown [Medicago truncatula] Length = 275 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -3 Query: 275 PEEVSSLVAFLCLPAASYITGQIIAVDGGMMAYGF 171 PEEVSSLV FLCLPAASYITGQ+I VDGG+ +GF Sbjct: 234 PEEVSSLVTFLCLPAASYITGQVICVDGGLTVFGF 268 >ref|ZP_10205577.1| tropinone reductase [Rhodanobacter thiooxydans LCS2] gi|388441441|gb|EIL97717.1| tropinone reductase [Rhodanobacter thiooxydans LCS2] Length = 260 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = -3 Query: 275 PEEVSSLVAFLCLPAASYITGQIIAVDGGMMAYGF 171 PEEV++ +AFLCLPAASYITGQ++AVDGG ++YGF Sbjct: 226 PEEVAAAIAFLCLPAASYITGQVLAVDGGFLSYGF 260 >emb|CBI16078.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 275 PEEVSSLVAFLCLPAASYITGQIIAVDGGMMAYGF 171 PEEVSSLVAFLCLPA+SYITGQII VDGGM GF Sbjct: 213 PEEVSSLVAFLCLPASSYITGQIICVDGGMSVNGF 247 >ref|XP_002282638.1| PREDICTED: tropinone reductase homolog At1g07440 [Vitis vinifera] Length = 318 Score = 62.8 bits (151), Expect = 3e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 275 PEEVSSLVAFLCLPAASYITGQIIAVDGGMMAYGF 171 PEEVSSLVAFLCLPA+SYITGQII VDGGM GF Sbjct: 279 PEEVSSLVAFLCLPASSYITGQIICVDGGMSVNGF 313