BLASTX nr result
ID: Cephaelis21_contig00034364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00034364 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEJ72569.1| putative reverse transcriptase family member [Mal... 61 1e-07 emb|CCH50976.1| T4.15 [Malus x robusta] 59 4e-07 emb|CBL94165.1| putative reverse transcriptase family member [Ma... 56 3e-06 gb|AEL30371.1| TIR-NBS-LRR type disease resistance protein [Arac... 55 5e-06 ref|XP_003581610.1| PREDICTED: uncharacterized protein LOC100840... 55 6e-06 >gb|AEJ72569.1| putative reverse transcriptase family member [Malus x domestica] Length = 212 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/50 (58%), Positives = 34/50 (68%) Frame = +3 Query: 111 IRPAMLYG*EFWDTSYEHEQTMRVTELRMLRKMCRHTRLNIIRNENTLGR 260 IRPAMLYG E W Y+H M V E+RMLR MC HTR + IRNE+ G+ Sbjct: 76 IRPAMLYGTECWAVKYQHVHKMGVAEMRMLRWMCGHTRKDKIRNEDIRGK 125 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/50 (56%), Positives = 34/50 (68%) Frame = +3 Query: 111 IRPAMLYG*EFWDTSYEHEQTMRVTELRMLRKMCRHTRLNIIRNENTLGR 260 IRPAMLYG E W ++H M V E+RMLR MC HTR + IRNE+ G+ Sbjct: 850 IRPAMLYGTECWAVKHQHVHKMGVAEMRMLRWMCGHTRKDKIRNEDIRGK 899 >emb|CBL94165.1| putative reverse transcriptase family member [Malus x domestica] Length = 163 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/50 (54%), Positives = 33/50 (66%) Frame = +3 Query: 111 IRPAMLYG*EFWDTSYEHEQTMRVTELRMLRKMCRHTRLNIIRNENTLGR 260 IRPAMLY E W ++H M V E+RMLR MCRHTR + I NE+ G+ Sbjct: 28 IRPAMLYDIECWAVKHQHVHKMGVAEIRMLRGMCRHTRKDKIVNEDIRGK 77 >gb|AEL30371.1| TIR-NBS-LRR type disease resistance protein [Arachis hypogaea] Length = 1939 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +3 Query: 111 IRPAMLYG*EFWDTSYEHEQTMRVTELRMLRKMCRHTRLNIIRNEN 248 IRPAMLYG E W EHE + V E++MLR M HTRL+ IRNE+ Sbjct: 1266 IRPAMLYGTECWAAKGEHEHKLSVAEMKMLRWMSGHTRLDKIRNED 1311 >ref|XP_003581610.1| PREDICTED: uncharacterized protein LOC100840703 [Brachypodium distachyon] Length = 567 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/50 (52%), Positives = 33/50 (66%) Frame = +3 Query: 111 IRPAMLYG*EFWDTSYEHEQTMRVTELRMLRKMCRHTRLNIIRNENTLGR 260 IRPA+LYG E W T H Q + V E+RMLR MC HTR + +RN++ R Sbjct: 433 IRPAILYGAECWPTKRRHVQQLGVAEMRMLRWMCGHTRRDRVRNDDIRDR 482