BLASTX nr result
ID: Cephaelis21_contig00034175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00034175 (548 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD28670.2| RNA-directed DNA polymerase (Reverse transcriptas... 55 7e-06 >gb|ABD28670.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 642 Score = 55.1 bits (131), Expect = 7e-06 Identities = 25/49 (51%), Positives = 33/49 (67%) Frame = -1 Query: 218 NILGIHRTSLPLQYLGCVLYQGQTKPVYFQPLIDKVSHKLDSWKGRLLS 72 NILG + SLP YLG +++G+ K ++FQP+ DKV KL WK LLS Sbjct: 483 NILGFNVGSLPFTYLGAPIFKGKPKGIHFQPIADKVKAKLAKWKASLLS 531