BLASTX nr result
ID: Cephaelis21_contig00033938
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033938 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16724.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002526504.1| protein with unknown function [Ricinus commu... 55 8e-06 ref|XP_002528787.1| protein with unknown function [Ricinus commu... 55 8e-06 ref|XP_002302484.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 ref|XP_002266653.1| PREDICTED: ras-related protein RABH1b [Vitis... 55 8e-06 >emb|CBI16724.3| unnamed protein product [Vitis vinifera] Length = 179 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 RVSIEEGEAKARDLNFMFIETSGKVGFNIKVI 98 +VSIEEGEAKARDLN MFIETS K GFNIK + Sbjct: 102 QVSIEEGEAKARDLNVMFIETSAKAGFNIKAL 133 >ref|XP_002526504.1| protein with unknown function [Ricinus communis] gi|223534179|gb|EEF35895.1| protein with unknown function [Ricinus communis] Length = 208 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 RVSIEEGEAKARDLNFMFIETSGKVGFNIKVI 98 +VSIEEGEAKARDLN MFIETS K GFNIK + Sbjct: 131 QVSIEEGEAKARDLNVMFIETSAKAGFNIKAL 162 >ref|XP_002528787.1| protein with unknown function [Ricinus communis] gi|223531790|gb|EEF33609.1| protein with unknown function [Ricinus communis] Length = 208 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 RVSIEEGEAKARDLNFMFIETSGKVGFNIKVI 98 +VSIEEGEAKARDLN MFIETS K GFNIK + Sbjct: 131 QVSIEEGEAKARDLNVMFIETSAKAGFNIKAL 162 >ref|XP_002302484.1| predicted protein [Populus trichocarpa] gi|222844210|gb|EEE81757.1| predicted protein [Populus trichocarpa] Length = 208 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 RVSIEEGEAKARDLNFMFIETSGKVGFNIKVI 98 +VSIEEGEAKARDLN MFIETS K GFNIK + Sbjct: 131 QVSIEEGEAKARDLNVMFIETSAKAGFNIKAL 162 >ref|XP_002266653.1| PREDICTED: ras-related protein RABH1b [Vitis vinifera] Length = 208 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 3 RVSIEEGEAKARDLNFMFIETSGKVGFNIKVI 98 +VSIEEGEAKARDLN MFIETS K GFNIK + Sbjct: 131 QVSIEEGEAKARDLNVMFIETSAKAGFNIKAL 162