BLASTX nr result
ID: Cephaelis21_contig00033877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033877 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001242691.1| uncharacterized protein LOC100808904 [Glycin... 60 1e-07 ref|XP_003544824.1| PREDICTED: protein tumorous imaginal discs, ... 59 4e-07 ref|XP_002302333.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002514017.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 ref|XP_004136261.1| PREDICTED: chaperone protein DnaJ-like [Cucu... 57 2e-06 >ref|NP_001242691.1| uncharacterized protein LOC100808904 [Glycine max] gi|255627083|gb|ACU13886.1| unknown [Glycine max] Length = 155 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 99 QDY*RILEVHYDLTEDAIRSNYIHLALKWHPDK 1 QDY +ILEV YD T+DAIRSNYI LALKWHPDK Sbjct: 56 QDYYKILEVDYDATDDAIRSNYIRLALKWHPDK 88 >ref|XP_003544824.1| PREDICTED: protein tumorous imaginal discs, mitochondrial-like [Glycine max] Length = 138 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 99 QDY*RILEVHYDLTEDAIRSNYIHLALKWHPDK 1 +DY +ILEV YD T+DAIRSNYI LALKWHPDK Sbjct: 39 KDYYKILEVDYDATDDAIRSNYIRLALKWHPDK 71 >ref|XP_002302333.1| predicted protein [Populus trichocarpa] gi|222844059|gb|EEE81606.1| predicted protein [Populus trichocarpa] Length = 141 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 99 QDY*RILEVHYDLTEDAIRSNYIHLALKWHPDK 1 +DY +ILEV YD T+DAIRSNYI LALKWHPDK Sbjct: 42 KDYYKILEVDYDATDDAIRSNYIRLALKWHPDK 74 >ref|XP_002514017.1| conserved hypothetical protein [Ricinus communis] gi|223547103|gb|EEF48600.1| conserved hypothetical protein [Ricinus communis] Length = 119 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 99 QDY*RILEVHYDLTEDAIRSNYIHLALKWHPDK 1 +DY +ILEV YD ++DAIRSNYI LALKWHPDK Sbjct: 38 KDYYKILEVDYDASDDAIRSNYIRLALKWHPDK 70 >ref|XP_004136261.1| PREDICTED: chaperone protein DnaJ-like [Cucumis sativus] gi|449497042|ref|XP_004160296.1| PREDICTED: chaperone protein DnaJ-like [Cucumis sativus] Length = 137 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -1 Query: 99 QDY*RILEVHYDLTEDAIRSNYIHLALKWHPDK 1 +DY +ILEV YD T+D IRSNYI LALKWHPDK Sbjct: 38 KDYYKILEVEYDATDDDIRSNYIRLALKWHPDK 70