BLASTX nr result
ID: Cephaelis21_contig00033869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033869 (400 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAV31177.2| hypothetical protein STB1_57t00015 [Solanum tuber... 55 8e-06 >gb|AAV31177.2| hypothetical protein STB1_57t00015 [Solanum tuberosum] Length = 443 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/50 (46%), Positives = 32/50 (64%) Frame = -2 Query: 153 TQDCGAYTMAFAEYYAMQKMELMKLDFDIEAFRQRVASLLYHYGTMKNQD 4 T DCG YT FAEY + ++ +D D + RQR A++L+HYG KN+D Sbjct: 353 TGDCGLYTCLFAEYISNDVFDMRSIDIDAKYHRQRYATILWHYGKTKNED 402