BLASTX nr result
ID: Cephaelis21_contig00033816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033816 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004169233.1| PREDICTED: triacylglycerol lipase 2-like [Cu... 57 2e-06 ref|XP_004143193.1| PREDICTED: triacylglycerol lipase 2-like iso... 57 2e-06 ref|XP_002276007.2| PREDICTED: triacylglycerol lipase 2 [Vitis v... 57 2e-06 emb|CBI28873.3| unnamed protein product [Vitis vinifera] 57 2e-06 ref|XP_002528967.1| Triacylglycerol lipase 2 precursor, putative... 55 8e-06 >ref|XP_004169233.1| PREDICTED: triacylglycerol lipase 2-like [Cucumis sativus] Length = 206 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/45 (51%), Positives = 37/45 (82%) Frame = +1 Query: 76 MNRLRSSGSSLYRNITMPQFRRKASHSWSAMKDTYFSAKDIFERH 210 M RLR+SG+S+ +I+ + +RKA +SW+A++DT++S KD+FERH Sbjct: 1 MQRLRASGTSIVSSISAARLKRKAVNSWTAVQDTFYSTKDVFERH 45 >ref|XP_004143193.1| PREDICTED: triacylglycerol lipase 2-like isoform 1 [Cucumis sativus] Length = 492 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/45 (51%), Positives = 37/45 (82%) Frame = +1 Query: 76 MNRLRSSGSSLYRNITMPQFRRKASHSWSAMKDTYFSAKDIFERH 210 M RLR+SG+S+ +I+ + +RKA +SW+A++DT++S KD+FERH Sbjct: 1 MQRLRASGTSIVSSISAARLKRKAVNSWTAVQDTFYSTKDVFERH 45 >ref|XP_002276007.2| PREDICTED: triacylglycerol lipase 2 [Vitis vinifera] Length = 612 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +1 Query: 76 MNRLRSSGSSLYRNITMPQFRRKASHSWSAMKDTYFSAKDIFERH 210 M RLR SG+SL + +P ++KA +SWSA++DTY S KD FERH Sbjct: 1 MQRLRISGTSLLGSFAVPHLKKKAMNSWSAVQDTYHSTKDTFERH 45 >emb|CBI28873.3| unnamed protein product [Vitis vinifera] Length = 197 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +1 Query: 76 MNRLRSSGSSLYRNITMPQFRRKASHSWSAMKDTYFSAKDIFERH 210 M RLR SG+SL + +P ++KA +SWSA++DTY S KD FERH Sbjct: 1 MQRLRISGTSLLGSFAVPHLKKKAMNSWSAVQDTYHSTKDTFERH 45 >ref|XP_002528967.1| Triacylglycerol lipase 2 precursor, putative [Ricinus communis] gi|223531613|gb|EEF33441.1| Triacylglycerol lipase 2 precursor, putative [Ricinus communis] Length = 485 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/45 (51%), Positives = 33/45 (73%) Frame = +1 Query: 76 MNRLRSSGSSLYRNITMPQFRRKASHSWSAMKDTYFSAKDIFERH 210 M R RS G++L + +P ++KA +SWSA++DTY S KD+FERH Sbjct: 1 MQRFRSKGTTLLGYLAVPHLKKKALNSWSAVQDTYSSTKDLFERH 45