BLASTX nr result
ID: Cephaelis21_contig00033746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033746 (372 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291825.1| orf57 gene product (mitochondrion) [Daucus c... 69 5e-10 >ref|YP_006291825.1| orf57 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374082010|gb|AEY81202.1| orf57 (mitochondrion) [Daucus carota subsp. sativus] Length = 122 Score = 68.6 bits (166), Expect = 5e-10 Identities = 36/110 (32%), Positives = 65/110 (59%), Gaps = 2/110 (1%) Frame = +1 Query: 28 MIKILIWNIRGVGGIASVRRLRKLCKIHSLSVVILLEPFFDNTRMLSLKSKLGFSDSIA- 204 MI L+WNIRG+G I S RR+ KL K++++S++ +LEP ++ +++ F+ S+A Sbjct: 1 MINNLLWNIRGIGNIKSRRRVGKLVKMYNISLIAILEPLHHANKIQEFSNRIRFNFSLAN 60 Query: 205 -PSSNKIWVFWRHNFPLQFQSQNDQFLHLRGSHPLSPEDFFITVIYAKCA 351 + +KIW+ W H + +Q + + L+ + +TV+YAKC+ Sbjct: 61 QEADDKIWLCWNHEVHVVLVDAFEQCITVDIGF-LNSDRVRLTVLYAKCS 109