BLASTX nr result
ID: Cephaelis21_contig00033697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033697 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523631.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002533258.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 emb|CAN69930.1| hypothetical protein VITISV_037144 [Vitis vinifera] 60 2e-07 ref|XP_002523628.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 ref|XP_002510645.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 >ref|XP_002523631.1| conserved hypothetical protein [Ricinus communis] gi|223537193|gb|EEF38826.1| conserved hypothetical protein [Ricinus communis] Length = 283 Score = 67.0 bits (162), Expect = 2e-09 Identities = 34/85 (40%), Positives = 54/85 (63%) Frame = -2 Query: 269 CYLAVVDDSSDAYHLMNLIKEIQQISLFVLDSTLSFISQSKTGSQTKGWSLVSKLIQQNA 90 C +V D+SD +++N++K ++ISL DS LSFISQ K S+ GWS VS ++Q Sbjct: 150 CRSSVSSDNSDLSNMINMLKGAEEISLAFFDSILSFISQPKMKSKPSGWSFVSNILQARR 209 Query: 89 ASCESERNSDIAAIEKVELQLHLLK 15 SCE + ++ +EK++ +L +LK Sbjct: 210 VSCEGKVETN--EVEKIDAELIVLK 232 >ref|XP_002533258.1| conserved hypothetical protein [Ricinus communis] gi|223526914|gb|EEF29120.1| conserved hypothetical protein [Ricinus communis] Length = 283 Score = 62.0 bits (149), Expect = 5e-08 Identities = 33/87 (37%), Positives = 53/87 (60%) Frame = -2 Query: 269 CYLAVVDDSSDAYHLMNLIKEIQQISLFVLDSTLSFISQSKTGSQTKGWSLVSKLIQQNA 90 C +V D+SD +++N++K ++ISL + +S LSFIS+ K S+ GWS VS ++Q Sbjct: 150 CRSSVSSDNSDLSNMINMLKGAEEISLALFESILSFISEPKVKSKPSGWSFVSNILQAKR 209 Query: 89 ASCESERNSDIAAIEKVELQLHLLKMS 9 S SE + +EK++ +L LK S Sbjct: 210 VS--SEGKVEANEVEKIDAELIALKAS 234 >emb|CAN69930.1| hypothetical protein VITISV_037144 [Vitis vinifera] Length = 298 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/81 (34%), Positives = 52/81 (64%) Frame = -2 Query: 269 CYLAVVDDSSDAYHLMNLIKEIQQISLFVLDSTLSFISQSKTGSQTKGWSLVSKLIQQNA 90 C + ++ + ++++++E++ ++L VL++ LS I+ GS+T GWSLVSKL+Q Sbjct: 162 CGFSALNKDTKILSMVSMLREVETVTLTVLEALLSLIAGPAAGSKTTGWSLVSKLMQHKR 221 Query: 89 ASCESERNSDIAAIEKVELQL 27 +CE E ++I+ EKV+ L Sbjct: 222 VACE-EAEAEISEFEKVDAAL 241 >ref|XP_002523628.1| conserved hypothetical protein [Ricinus communis] gi|223537190|gb|EEF38823.1| conserved hypothetical protein [Ricinus communis] Length = 283 Score = 59.3 bits (142), Expect = 3e-07 Identities = 31/87 (35%), Positives = 52/87 (59%) Frame = -2 Query: 269 CYLAVVDDSSDAYHLMNLIKEIQQISLFVLDSTLSFISQSKTGSQTKGWSLVSKLIQQNA 90 C ++ D+SD +++N++K ++ SL + +S LSFIS+ K S+ GWS VS ++Q Sbjct: 150 CRSSISSDNSDLSNMINMLKGAEESSLALFESILSFISEPKVKSKPSGWSFVSNILQAKR 209 Query: 89 ASCESERNSDIAAIEKVELQLHLLKMS 9 S SE + +EK++ +L LK S Sbjct: 210 VS--SEGKVEANEVEKIDAELITLKAS 234 >ref|XP_002510645.1| conserved hypothetical protein [Ricinus communis] gi|223551346|gb|EEF52832.1| conserved hypothetical protein [Ricinus communis] Length = 282 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/78 (37%), Positives = 50/78 (64%) Frame = -2 Query: 251 DDSSDAYHLMNLIKEIQQISLFVLDSTLSFISQSKTGSQTKGWSLVSKLIQQNAASCESE 72 + SD ++++KE+++IS+ VL+S LSF+S KT +++ GW+ V+KL Q SCE Sbjct: 159 EKKSDLTAAVSMLKEVEEISIVVLESLLSFVSPPKTRTRSTGWNAVTKLFQSGRVSCE-- 216 Query: 71 RNSDIAAIEKVELQLHLL 18 D +EK++ +L +L Sbjct: 217 ---DANEVEKMDAELIVL 231