BLASTX nr result
ID: Cephaelis21_contig00033664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033664 (585 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512404.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 ref|XP_003633606.1| PREDICTED: uncharacterized protein LOC100854... 55 9e-06 >ref|XP_002512404.1| conserved hypothetical protein [Ricinus communis] gi|223548365|gb|EEF49856.1| conserved hypothetical protein [Ricinus communis] Length = 118 Score = 62.4 bits (150), Expect = 5e-08 Identities = 28/47 (59%), Positives = 33/47 (70%) Frame = +1 Query: 412 TLSRHFCQHISCYFNESFSAHVVISGFWEGPDTEDGWGFVEAFVYQI 552 T + HF + +SC N S H VISG+W GPD +DGWGFVEAFV QI Sbjct: 71 TPTDHFGELVSCCMNVSLYNHKVISGYWVGPDIDDGWGFVEAFVNQI 117 >ref|XP_003633606.1| PREDICTED: uncharacterized protein LOC100854638 [Vitis vinifera] gi|296089660|emb|CBI39479.3| unnamed protein product [Vitis vinifera] Length = 103 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/44 (54%), Positives = 28/44 (63%) Frame = +1 Query: 421 RHFCQHISCYFNESFSAHVVISGFWEGPDTEDGWGFVEAFVYQI 552 R F + +S + N S VI G+W GPD EDGWGFV AFV QI Sbjct: 59 RRFWEPVSLHLNVSAGTETVICGYWVGPDIEDGWGFVNAFVNQI 102