BLASTX nr result
ID: Cephaelis21_contig00033599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033599 (274 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD38028.1| putative oligopeptidase [Oryza sativa Japonica G... 58 9e-07 gb|EEE69838.1| hypothetical protein OsJ_29605 [Oryza sativa Japo... 58 9e-07 ref|XP_002310764.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 dbj|BAK07503.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 3e-06 ref|XP_002522361.1| oligopeptidase B, putative [Ricinus communis... 55 5e-06 >dbj|BAD38028.1| putative oligopeptidase [Oryza sativa Japonica Group] Length = 796 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +2 Query: 110 FRIYCSILGISDDDTLLLEEPKENVYVNIRHTKD 211 +R++CSI+G S DD L+LEEP EN+Y+NIRHTKD Sbjct: 253 YRLFCSIIGSSKDDVLMLEEPDENIYLNIRHTKD 286 >gb|EEE69838.1| hypothetical protein OsJ_29605 [Oryza sativa Japonica Group] Length = 992 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +2 Query: 110 FRIYCSILGISDDDTLLLEEPKENVYVNIRHTKD 211 +R++CSI+G S DD L+LEEP EN+Y+NIRHTKD Sbjct: 253 YRLFCSIIGSSKDDVLMLEEPDENIYLNIRHTKD 286 >ref|XP_002310764.1| predicted protein [Populus trichocarpa] gi|222853667|gb|EEE91214.1| predicted protein [Populus trichocarpa] Length = 730 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = +2 Query: 113 RIYCSILGISDDDTLLLEEPKENVYVNIRHTKD 211 RIYCS++G +++D LLL+EP ENVYVNIRHTKD Sbjct: 239 RIYCSMIGSTEEDVLLLDEPAENVYVNIRHTKD 271 >dbj|BAK07503.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 785 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/34 (64%), Positives = 30/34 (88%) Frame = +2 Query: 110 FRIYCSILGISDDDTLLLEEPKENVYVNIRHTKD 211 +R++CSI+G + DD L+LEEP EN+Y+NIRHTKD Sbjct: 253 YRLFCSIIGSNKDDILILEEPDENIYLNIRHTKD 286 >ref|XP_002522361.1| oligopeptidase B, putative [Ricinus communis] gi|223538439|gb|EEF40045.1| oligopeptidase B, putative [Ricinus communis] Length = 788 Score = 55.5 bits (132), Expect = 5e-06 Identities = 21/33 (63%), Positives = 30/33 (90%) Frame = +2 Query: 113 RIYCSILGISDDDTLLLEEPKENVYVNIRHTKD 211 R+YCS++G +D+D LLL+EP +NV++NIRHTKD Sbjct: 254 RLYCSMIGSTDEDVLLLDEPNDNVFINIRHTKD 286