BLASTX nr result
ID: Cephaelis21_contig00033562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00033562 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis]... 85 5e-15 gb|AEK71539.1| hypothetical chloroplast RF2 [Phyllanthus calycinus] 85 5e-15 gb|ADD30880.1| putative RF2 protein [Aucuba japonica] gi|3408071... 85 5e-15 ref|YP_740519.1| hypothetical chloroplast RF2 [Citrus sinensis] ... 85 5e-15 ref|YP_087009.1| Ycf2 [Panax ginseng] gi|52220874|ref|YP_087028.... 85 7e-15 >ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|442743025|ref|YP_007353977.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|438687647|emb|CCP47174.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438687666|emb|CCP47196.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688331|emb|CCP47263.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688350|emb|CCP47285.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688455|emb|CCP47352.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688474|emb|CCP47374.1| ycf2 protein (chloroplast) [Tectona grandis] Length = 2287 Score = 85.1 bits (209), Expect = 5e-15 Identities = 40/54 (74%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = +1 Query: 121 SDFXXXXXXXALDPQQIEEDLFNHIVWAPRIWRPWAFLF---EMPNELGFPYRS 273 S+F ALDPQQIEEDLFNHIVWAPRIWRPW FLF E PNELGFPY S Sbjct: 2057 SEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYLS 2110 >gb|AEK71539.1| hypothetical chloroplast RF2 [Phyllanthus calycinus] Length = 2270 Score = 85.1 bits (209), Expect = 5e-15 Identities = 39/54 (72%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = +1 Query: 121 SDFXXXXXXXALDPQQIEEDLFNHIVWAPRIWRPWAFLF---EMPNELGFPYRS 273 S+F LDPQQIEEDLFNHIVWAPRIWRPW FLF E PNELGFPYR+ Sbjct: 2040 SEFEEGEGEGVLDPQQIEEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYRA 2093 >gb|ADD30880.1| putative RF2 protein [Aucuba japonica] gi|340807108|gb|AEK71709.1| hypothetical chloroplast RF2 [Aucuba japonica] Length = 2278 Score = 85.1 bits (209), Expect = 5e-15 Identities = 40/54 (74%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = +1 Query: 121 SDFXXXXXXXALDPQQIEEDLFNHIVWAPRIWRPWAFLF---EMPNELGFPYRS 273 S+F ALDPQQIEEDLFNHIVWAPRIWRPW FLF E PNELGFPY S Sbjct: 2048 SEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYGS 2101 >ref|YP_740519.1| hypothetical chloroplast RF2 [Citrus sinensis] gi|114329720|ref|YP_740539.1| hypothetical chloroplast RF2 [Citrus sinensis] gi|122166130|sp|Q09MB4.1|YCF2_CITSI RecName: Full=Protein ycf2 gi|113952664|gb|ABI49062.1| hypothetical chloroplast RF2 [Citrus sinensis] gi|113952686|gb|ABI49084.1| hypothetical chloroplast RF2 [Citrus sinensis] Length = 2282 Score = 85.1 bits (209), Expect = 5e-15 Identities = 39/54 (72%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = +1 Query: 121 SDFXXXXXXXALDPQQIEEDLFNHIVWAPRIWRPWAFLF---EMPNELGFPYRS 273 S+F LDPQQIEEDLFNHIVWAPRIWRPW FLF E PNELGFPYR+ Sbjct: 2052 SEFEEGEGEGVLDPQQIEEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYRA 2105 >ref|YP_087009.1| Ycf2 [Panax ginseng] gi|52220874|ref|YP_087028.1| Ycf2 [Panax ginseng] gi|68053092|sp|Q68RU4.1|YCF2_PANGI RecName: Full=Protein ycf2 gi|51235356|gb|AAT98552.1| ycf2 protein [Panax ginseng] gi|51235377|gb|AAT98573.1| ycf2 protein [Panax ginseng] Length = 2110 Score = 84.7 bits (208), Expect = 7e-15 Identities = 40/54 (74%), Positives = 41/54 (75%), Gaps = 3/54 (5%) Frame = +1 Query: 121 SDFXXXXXXXALDPQQIEEDLFNHIVWAPRIWRPWAFLF---EMPNELGFPYRS 273 S+F ALDPQQIEEDLFNHIVWAPRIWRPW FLF E PNELGFPY S Sbjct: 1864 SEFEEGEGEGALDPQQIEEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYWS 1917